Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR221 IGR220 IGR217 IGR223 IGR219 IGR218 IGR222 TP0274 TP0276 ctp, - TP0277 TP0280 TP0278 kdtB, - TP0283 TP0282 TP0285 rpsA, - TP0279 TP0274 TP0276 ctp, - TP0277 TP0280 TP0278 kdtB, - TP0283 TP0282 TP0285 rpsA, - TP0279 Type: tandem, Name:  - 240 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: tandem, Name:  - 239 TP0276 ctp, - TP0277 TP0275 TP0274 TP0275 TP0278 kdtB, - TP0283 TP0282 TP0285 rpsA, - TP0279 TP0281 TP0286 TP0284 TP0284 TP0286 TP0280 TP0281
* Calculated from Protein Sequence

Gene ID: TP0279

DNA Molecule Name:
1  

Genbank ID:
3322552

Gene Name:
rpsA  

Definition:
30S ribosomal protein S1/ cytidylate kinase

Gene Start:
294243

Gene Stop:
296831

Gene Length:
2589

Molecular Weight*:
95558

pI*:
7.76

Net Charge*:
5.73

EC:
 

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Translation; Ribosomal proteins  

Pathway: pathway table

Comment:
This protein contains an N-terminal region that does not exist in most
other ribosomal protein S1 proteins and matches well to cytidylate kinase
proteins.
Residues 569-843 correspond to the ribosomal S1 protein while
residues 1-240 correspond to the cytidylate kinase protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to 30S ribosomal
protein S1. For example residues 308-851 are 31% similar to ribosomal
protein S1 of Borrelia burgdorferi, (AE001124).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0539
COG name: Ribosomal protein S1
Functional Class:  J
The phylogenetic pattern of COG0539 is ----YqvCebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 322-340, 579-597, 340-354, 645-659, 423-440, 457-477, 546-566,
514-535, 687-708, 774-795, 600-621, 592-611, 679-698, 766-785, 335-354,
719-737, 632-650, 545-563, and 547-565 represent significant (100%)
hits to blocks PR00681A,B,E,F,G,H,I, ribosomal protein S1 proteins.
Residues 36-51 represent significant (96%) hits to block PR00364A,
DISEASE RESISTANCE PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 135-227 are 37% similar to CYTIDYLATE KINASE of KCY_ECOLI.
Residues 37-83 also support this match. Residues 495-560 are 37%
similar to TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT of IF2A_METJA.
Residues 580-646 also support this match. Residues 41-86 are 43%
similar to GTP:AMP PHOSPHOTRANSFERASE MITOCHONDRIAL of KAD3_HUMAN,
however the E value is low for this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0924 tex protein and
TP0886 polyribonucleotide nucleotidyltransferase. Residues 488-844
are more than 25% similar to TP0924 and residues 499-729 are more
than 29% similar to TP0886.


Pfam Summary:  Pfam Search
Residues 129 to 281 (E-value = 3.2e-83) place TP0279 in the Cytidylate_kin family which is described as Cytidylate kinase (PF02224)
Residues 490 to 562 (E-value = 3.9e-21) place TP0279 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 575 to 649 (E-value = 3.1e-23) place TP0279 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 662 to 736 (E-value = 1.1e-16) place TP0279 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 749 to 825 (E-value = 1.3e-13) place TP0279 in the S1 family which is described as S1 RNA binding domain (PF00575)

PDB Hit:
none

Gene Protein Sequence:
MHGGGERERSFVHPRTRCVAVRARTVLQCRPMGTVIIALDGPAGSGKSSV
CRLLASRLGAQCLNTGSFYRAFTLAALRRVSELAVQACSPSPDPDAAVGC
AAVPHATNLDTSYAPLTAQKKVALFDEAYWVSFARTVALSYRAGVMYVGE
ENVESLLRSDEVESAVSYFAAMPAIRAIMTGKIRSAVCGARVVCEGRDLT
TVVFVDADLKCYLDASIEARVARRWAQGTSRLSKQELEQRMRARDAHDRA
RTVGGLRCAPDALYVDTSCLTIEEVCERIAREAHRRALWGGERSVENQEG
KGTPLVPRQLQERYSFEAPEPGSVRMGTVVQVNAGTVFVDIGGKSEGRVP
VEEFEAPPKAGDGVRVYVERVTPYGPELSKTKADRLGLKVKLRDAERDGT
PVEGRIVRLTEKKSGFEVDLGAGMMAFLPISQSDCQKVDAPESLIGLTSK
FYIERISQSKQHRGNDNIVINRRRYLEERARQAREEFFNSVHIEDSVSGV
VKSFTSFGAFIDLGGFDGLLHVNDMSWGHVARPREFVKKGQTIELKVIRL
DQAEKRINLSLKHFQPDPWLEFENKFGVNDVVKGRVTKIADFGAFIELAE
GIEGLAHISEFSWVKKTSKPSDMVKIGDEVECMILGYDIQAGRVSLGLKQ
VTANPWEEIEARYPVGARFTRRIVKVTNAGAFIEMEEGIDGFLHVDDLSW
VKRTRPADHELEVGKEIECMVIECDPQARRIRLGVKQLSDNPWQVFANAY
GVGSTVEGEVSSVTDFGIFVRVPGGVEGLVRKQHLVENRDGDPGEALRKY
AVGDRVKAVIVDMNVKDRKVAFSVRDYQRKVQRDELSRYMSAPRGEDEGS
FTLGDLMRQTSGK

Gene Nucleotide Sequence:  Sequence Viewer
GTGCATGGGGGGGGGGAGAGAGAGAGAAGTTTCGTTCATCCTCGCACCCG
TTGCGTTGCGGTGCGTGCAAGGACTGTGCTACAGTGCCGGCCGATGGGGA
CCGTGATCATCGCTCTTGATGGACCTGCAGGCTCTGGGAAGAGCAGCGTC
TGTCGTCTGCTCGCGTCTCGCCTTGGCGCGCAATGTTTGAACACGGGTTC
TTTCTACCGTGCATTTACCCTCGCCGCATTGCGTAGGGTATCGGAGTTGG
CCGTGCAAGCGTGCTCTCCTTCTCCGGACCCTGATGCGGCGGTCGGGTGC
GCGGCTGTTCCACACGCAACAAATCTGGACACATCATATGCTCCTCTGAC
GGCCCAGAAGAAGGTTGCACTTTTTGATGAAGCGTATTGGGTTTCGTTTG
CGCGCACAGTTGCGCTTTCTTATCGTGCGGGTGTGATGTACGTGGGCGAA
GAGAACGTGGAGTCACTGCTGCGTTCGGATGAGGTGGAGTCGGCAGTCTC
GTACTTCGCGGCAATGCCGGCTATTCGGGCAATTATGACGGGGAAGATCC
GGTCGGCCGTTTGTGGTGCGCGGGTAGTTTGTGAAGGGCGTGATCTAACG
ACGGTTGTGTTTGTGGATGCGGACTTGAAGTGCTACCTTGACGCTTCTAT
TGAGGCGCGTGTGGCGCGTCGTTGGGCGCAGGGAACGAGCCGGTTATCGA
AGCAGGAACTCGAGCAGCGCATGCGCGCGCGTGACGCACACGACAGGGCG
CGCACCGTGGGGGGGCTCAGGTGTGCGCCTGATGCGCTGTACGTGGATAC
TTCTTGCTTGACCATTGAGGAGGTTTGTGAAAGAATYGCGCGCGAGGCGC
ACCGCAGAGCTTTGTGGGGAGGAGAGCGTTCAGTGGAAAATCAGGAGGGG
AAGGGTACACCATTGGTGCCGCGGCAGCTGCAGGAGCGGTATTCGTTTGA
GGCTCCGGAACCTGGTTCTGTTAGGATGGGGACGGTGGTTCAGGTTAATG
CGGGGACGGTGTTTGTAGACATCGGGGGAAAATCTGAAGGGCGCGTTCCA
GTGGAAGAGTTTGAGGCGCCGCCGAAGGCAGGGGATGGCGTTCGGGTGTA
TGTGGAGCGCGTGACGCCTTATGGCCCTGAGCTTTCCAAGACGAAGGCCG
ATCGCTTGGGTTTGAAAGTTAAGTTACGTGATGCGGAGCGAGACGGGACT
CCGGTTGAGGGGAGGATCGTCCGTCTAACGGAAAAGAAGAGTGGTTTTGA
AGTGGACTTGGGTGCGGGGATGATGGCCTTTTTACCTATCAGCCAGTCGG
ACTGTCAGAAAGTCGACGCGCCTGAGAGTCTCATTGGGCTTACGTCTAAG
TTCTATATCGAGCGTATATCCCAAAGCAAACAGCATCGCGGCAACGACAA
CATTGTCATTAATCGACGCCGGTATTTGGAGGAGCGTGCGCGGCAGGCGC
GCGAGGAGTTCTTCAATTCGGTTCATATTGAAGATTCCGTATCCGGAGTG
GTTAAGAGCTTTACGAGTTTTGGTGCTTTCATTGACTTGGGCGGTTTCGA
TGGCCTCCTGCATGTGAATGACATGAGCTGGGGGCACGTGGCGCGGCCGC
GCGAGTTTGTGAAGAAAGGACAAACCATTGAGTTGAAGGTTATCCGCCTG
GATCAGGCGGAGAAGCGTATCAATTTGTCCCTGAAGCATTTTCAGCCGGA
TCCGTGGCTTGAGTTTGAAAACAAGTTCGGCGTGAATGATGTGGTCAAGG
GGCGTGTAACGAAAATCGCTGATTTCGGTGCGTTCATTGAACTTGCTGAG
GGTATCGAGGGGCTTGCGCATATTAGTGAGTTCAGCTGGGTAAAGAAAAC
GAGTAAACCCAGTGACATGGTTAAAATTGGGGATGAAGTGGAGTGTATGA
TCCTCGGGTATGATATCCAGGCGGGACGGGTGTCTCTGGGGCTTAAGCAG
GTAACGGCGAATCCTTGGGAGGAAATAGAGGCTCGTTATCCTGTGGGTGC
GCGCTTTACGCGCCGTATCGTAAAGGTTACGAACGCAGGTGCTTTCATTG
AAATGGAAGAGGGAATAGACGGCTTTTTGCACGTCGATGATCTGTCCTGG
GTTAAGCGGACGCGTCCTGCAGACCATGAGCTTGAGGTAGGTAAAGAAAT
CGAGTGTATGGTTATCGAGTGTGATCCGCAAGCGCGCCGTATTCGGCTTG
GTGTTAAGCAGTTGAGCGACAATCCGTGGCAGGTGTTTGCGAACGCCTAT
GGGGTAGGGTCTACCGTGGAGGGGGAAGTATCTTCCGTGACGGATTTTGG
GATTTTCGTGCGTGTTCCCGGTGGCGTTGAGGGGCTTGTTCGCAAGCAGC
ATCTGGTTGAGAATCGGGATGGGGATCCGGGTGAAGCGCTAAGGAAATAC
GCAGTGGGGGACCGGGTCAAGGCAGTGATCGTAGATATGAACGTGAAGGA
CAGGAAGGTTGCTTTTTCTGTTAGAGACTATCAAAGAAAGGTACAGCGTG
ACGAGCTTTCTCGGTATATGTCCGCCCCGCGGGGGGAGGACGAAGGCTCG
TTTACGCTCGGTGATTTGATGAGGCAAACGTCTGGAAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy