Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR221 IGR216 IGR220 IGR217 IGR219 IGR215 IGR218 IGR222 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0278 TP0280 kdtB, - TP0283 TP0282 TP0273 rpsA, - TP0279 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0278 TP0280 kdtB, - TP0283 TP0282 TP0273 rpsA, - TP0279 Type: tandem, Name:  - 289 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: tandem, Name:  - 239 TP0274 TP0276 ctp, - TP0277 TP0275 parA, - TP0272 TP0275 parA, - TP0272 parB, - TP0271 TP0278 kdtB, - TP0283 TP0282 TP0273 rpsA, - TP0279 TP0281 TP0280 TP0281
* Calculated from Protein Sequence

Gene ID: TP0277

DNA Molecule Name:
1  

Genbank ID:
3322551

Gene Name:
ctp  

Definition:
carboxyl-terminal protease

Gene Start:
293941

Gene Stop:
292598

Gene Length:
1344

Molecular Weight*:
50306

pI*:
9.97

Net Charge*:
9.44

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is involved in the cleavage of a C-terminal peptide.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to carboxyl terminal
proteases. For example residues 2-419 are 33% similar to carboxyl-
terminal protease (ctp) of Borrelia burgdorferi,(AE001141).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0793
COG name: Periplasmic protease
Functional Class:  M
The phylogenetic pattern of COG0793 is -----qvCeB-huj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 38-228 are 31% similar to a region of YPEB_SYNP2, a
hypothetical protein with similarity to serine proteases and
hydrolases. Residues 256-290 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 165 to 334 (E-value = 5.4e-65) place TP0277 in the Peptidase_S41 family which is described as Peptidase family S41B (PF03572)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
96  
193

PDB Hit:
none

Gene Protein Sequence:
MQTVQDVYEFLRKYYVDEVDPHILYKGALEGMINSLQDPYTTFVESDSIS
GVNLQDTTKGFFGGIGVVISKSRTSTPGKPAYVEVTAAIEDTPSWKGGIR
PRDLIVKIGTMSTDTMTMDEVLKKLRGPIGTKVTLVVKRGTKIFRPFTLT
RAKIEIPTVKYAKIDPNIAYVRLIEFNPVTATRMVETVTELRRQGCDRLI
LDLRNNPGGLITAAVDVTSSFIPSGTVVTTKSRVQGHSITFSVNARAQKL
PPSMPVIVLINRDSASASEIVSGALKDHKRAYLVGQTTYGKGVVQQVFDL
NERESLKMTISRYYTPSDANIDKSGIPPDLEVRETEFTPEEEEALVSLFK
SEKVKLFAEQNRTMNSERIKQYARGLAREFKLRSILVEKLIAQEYHRHNA
SFVYDLEYDEQLRKAVELIRTQDIHALVARTKTVKELQEGIQEKKKVS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGACGGTGCAGGATGTCTACGAATTCCTCCGCAAATACTACGTCGA
CGAGGTAGACCCCCACATCCTCTACAAGGGGGCACTAGAAGGCATGATTA
ACTCTCTTCAGGACCCTTACACAACCTTCGTCGAAAGCGACAGCATCAGC
GGCGTTAATCTCCAAGACACTACCAAGGGTTTCTTTGGCGGCATCGGCGT
TGTCATTTCTAAGTCCAGAACATCCACTCCGGGCAAACCCGCCTACGTGG
AAGTGACCGCCGCCATTGAAGACACTCCTTCCTGGAAAGGAGGAATCAGA
CCGAGGGACCTCATCGTCAAAATCGGCACCATGAGCACTGACACCATGAC
TATGGACGAGGTTTTAAAGAAACTACGGGGGCCGATAGGCACCAAGGTGA
CTCTTGTTGTCAAACGGGGTACAAAGATTTTCCGACCATTCACCCTCACC
CGTGCGAAAATTGAAATTCCCACTGTTAAGTACGCAAAAATCGATCCAAA
CATCGCGTACGTGCGCCTCATAGAGTTCAACCCAGTCACCGCTACCCGCA
TGGTAGAAACCGTTACCGAACTGCGTAGGCAAGGTTGCGACCGTCTCATT
CTCGACCTGCGCAACAATCCAGGCGGCCTTATCACCGCCGCAGTGGACGT
TACCAGCTCATTCATTCCCTCCGGAACCGTTGTAACCACTAAGTCACGCG
TGCAGGGACACTCCATAACGTTCAGCGTTAACGCACGTGCGCAGAAGCTA
CCTCCGTCTATGCCTGTGATTGTTCTCATCAACAGGGATTCTGCGTCCGC
TTCAGAAATCGTTTCAGGTGCGCTAAAAGACCACAAGCGCGCATATCTGG
TCGGCCAAACCACATACGGAAAGGGAGTCGTGCAGCAAGTCTTTGACCTC
AATGAACGGGAGAGTTTGAAAATGACTATCTCACGCTACTACACCCCAAG
CGACGCAAATATCGATAAGAGCGGCATTCCGCCGGACCTCGAGGTACGAG
AAACAGAGTTTACTCCCGAGGAAGAAGAGGCACTTGTCAGTCTATTTAAG
TCTGAAAAAGTGAAACTCTTTGCAGAGCAGAACCGTACCATGAACTCCGA
ACGCATAAAACAGTATGCACGTGGCCTGGCACGCGAATTTAAACTCCGAT
CAATACTGGTGGAAAAGCTCATCGCACAGGAGTATCACCGGCACAATGCG
TCTTTTGTATATGACTTAGAATATGATGAACAGCTGCGAAAGGCGGTGGA
GTTGATACGCACACAGGATATTCACGCGCTGGTGGCGCGTACTAAAACGG
TCAAAGAATTGCAAGAGGGAATACAGGAAAAAAAGAAGGTATCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy