Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR214 IGR216 IGR220 IGR217 IGR219 IGR215 IGR218 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0278 TP0273 pcnA, - TP0270 rpsA, - TP0279 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0278 TP0273 pcnA, - TP0270 rpsA, - TP0279 Type: tandem, Name:  - 239 Type: tandem, Name:  - 69 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: tandem, Name:  - 289 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0275 parA, - TP0272 TP0275 parA, - TP0272 TP0278 TP0273 pcnA, - TP0270 rpsA, - TP0279
* Calculated from Protein Sequence

Gene ID: TP0275

DNA Molecule Name:
1  

Genbank ID:
3322549

Gene Name:


Definition:
UDP-N-acetyl-D-mannosamine transferase

Gene Start:
291559

Gene Stop:
290813

Gene Length:
747

Molecular Weight*:
28925

pI*:
11.33

Net Charge*:
20.54

EC:
2.4.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism
Metabolism of complex lipids; Glycerolipid metabolism

Secondary Evidence:
Tsukamoto T, Kinoshita Y, Taga S, Takeda Y, Miwatani T.
Value of passive immune hemolysis for detection of heat-labile enterotoxin produced by enterotoxigenic Escherichia coli.
J Clin Microbiol. 1980 Dec;12(6):768-71.
PMID: 7031077

Meier-Dieter U, Barr K, Starman R, Hatch L, Rick PD.
Nucleotide sequence of the Escherichia coli rfe gene involved in the synthesis of enterobacterial common antigen. Molecular cloning of the rfe-rff gene cluster.
J Biol Chem. 1992 Jan;267(2):746-53.
PMID: 1730666

Comment:
In E. coli this protein is involved in the synthesis of enterobacterial
common antigen (eca) and required for synthesis of liposaccharide
O-side chains.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed two significant hits to UDP-N-acetyl-D-
mannosaminuronic acid transferases. For example residues 13-180 are
22% similar to UDP-N-acetyl-D-mannosaminuronic acid transferase of
Synechocystis sp., (D90899).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1922
COG name: Teichoic acid biosynthesis proteins
Functional Class:? M
The phylogenetic pattern of COG1922 is ------vCeb-------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 99-227 are 24% similar to TEICHOIC ACID BIOSYNTHESIS PROTEIN
A of TAGA_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 60 to 230 (E-value = 6.9e-68) place TP0275 in the Glyco_tran_WecB family which is described as Glycosyl transferase WecB/TagA/CpsF family (PF03808)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
87  
105
transmembrane  
153  
170

PDB Hit:
none

Gene Protein Sequence:
MEQTQLVTRIEFLSVPLDVVREEYLCTVILSLLEKKEPQHIIFLSLWDVL
KARHNHEFRTMVGRAALCLPTSYSIVRGARFLGLPTPIFRHPFQFIITLL
NVMDTHYKSLYLFGGRGQSLLEAERNVHSTFPGLSVVGRFHGFYRKTLEN
NIITAIVKSNASLVIVGNGVPGGVRWIARNRAHFAGGIFVQDSEVIDIFS
KRRKRPRAKELLHGRSPWGQTLHPLRWHRSVRYVWYIFLLLFYRIFRTK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACAAACGCAGCTGGTAACGCGCATTGAGTTCCTTTCCGTACCCCT
TGATGTGGTGCGTGAAGAGTATCTGTGCACCGTCATTCTCTCCCTGTTAG
AAAAAAAAGAGCCGCAGCACATTATATTTCTTTCTCTCTGGGACGTGCTA
AAGGCACGGCATAATCACGAGTTCCGCACCATGGTAGGCCGCGCAGCGTT
GTGTCTGCCCACATCCTACAGTATTGTGCGCGGTGCACGCTTTTTGGGAT
TGCCGACACCTATCTTTCGGCACCCGTTTCAATTCATCATCACCTTGCTC
AACGTTATGGACACGCACTACAAATCACTCTACTTGTTCGGCGGTCGGGG
ACAGAGTCTGCTCGAGGCGGAGCGTAACGTGCATTCTACCTTTCCCGGAC
TGAGCGTGGTAGGTCGATTTCACGGCTTTTATCGTAAGACGTTAGAAAAC
AACATTATCACGGCAATTGTAAAATCCAACGCATCGCTGGTAATTGTCGG
CAATGGGGTACCAGGAGGCGTACGATGGATTGCGCGCAATCGCGCACACT
TCGCCGGTGGCATTTTTGTGCAAGACAGCGAGGTTATCGACATTTTCTCA
AAACGGCGCAAACGACCACGCGCAAAAGAACTGTTACACGGACGCAGTCC
CTGGGGACAAACACTGCATCCATTGCGCTGGCACAGGAGCGTGCGATACG
TATGGTATATCTTTCTCTTGCTTTTCTACCGTATATTCCGCACGAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy