Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR214 IGR216 IGR220 IGR213 IGR217 IGR219 IGR215 IGR218 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0278 TP0273 pcnA, - TP0270 TP0269 rpsA, - TP0279 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0278 TP0273 pcnA, - TP0270 TP0269 rpsA, - TP0279 Type: tandem, Name:  - 239 Type: tandem, Name:  - 69 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: tandem, Name:  - 289 TP0274 TP0276 parB, - TP0271 ctp, - TP0277 TP0275 parA, - TP0272 TP0275 parA, - TP0272 TP0278 TP0273 pcnA, - TP0270 TP0269 rpsA, - TP0279
* Calculated from Protein Sequence

Gene ID: TP0274

DNA Molecule Name:
1  

Genbank ID:
3322548

Gene Name:


Definition:
deoxycytidylate deaminase (dCMP deaminase)

Gene Start:
290721

Gene Stop:
290224

Gene Length:
498

Molecular Weight*:
18394

pI*:
6.98

Net Charge*:
-0.12

EC:
3.5.4.12  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
This enzyme supplies the nulceotide substrate for thymidylate synthetase.

Reaction:
DCMP + H(2)O = DUMP + NH(3).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to deoxycytidylate
deaminase (dCMP deaminase) proteins. For example residues 10-153 are
47% similar to dCMP deaminase of Archaeoglobus fulgidus,(AE000981).

COGS Summary:  COGS Search
BeTs to 6 clades of COG2131
COG name: Deoxycytidylate deaminase
Functional Class:  F
The phylogenetic pattern of COG2131 is a--ky-v--b-------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 86-92 and 104-121 represent significant (98%) hits to blocks
BL00903A,B, Cytidine and deoxycytidylate deaminase zinc-binding
regions.

ProDom Summary:  Protein Domain Search
Residues 17-60 are 43% similar to DEOXYCYTIDYLATE DEAMINASE of
DCTD_YEAST. Residues 36-59 and 86-150 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 12 to 133 (E-value = 7.3e-39) place TP0274 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)

PDB Hit:
none

Gene Protein Sequence:
MGQREELVTRPSWDEYFMEVCHAIAKRATCDRGRAGCVIARDHHLLVTGY
AGAPRGLLHCDEHGHQLRTVQHEDGTCTQHCVRTVHAEQNALCQAARLGI
GLEGATLYCTMTPCRTCAMLIINCGIVRVVAEKRYQTATESIMLFAQAQI
ALEHIYQNPAEYGTPS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGACAACGTGAGGAGTTGGTTACGCGACCGAGTTGGGATGAGTATTT
TATGGAAGTGTGTCATGCAATTGCCAAGCGTGCCACCTGCGATCGCGGAC
GCGCAGGCTGCGTCATAGCGCGCGATCACCATCTGCTTGTAACTGGGTAT
GCAGGCGCACCGCGAGGTCTCCTGCATTGTGACGAACATGGACACCAGCT
ACGCACGGTGCAGCATGAAGACGGGACGTGCACGCAGCATTGCGTTCGCA
CCGTGCACGCAGAGCAAAACGCCCTCTGCCAGGCAGCGCGTTTGGGCATC
GGTCTAGAGGGCGCAACACTCTACTGTACCATGACACCGTGCCGCACCTG
TGCAATGCTCATCATTAACTGCGGCATTGTGCGTGTCGTTGCTGAGAAGC
GTTATCAGACTGCGACAGAAAGTATCATGCTGTTTGCACAAGCACAGATC
GCGCTTGAGCACATATACCAAAATCCTGCTGAGTACGGCACCCCCTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy