Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap rRNA-5SrRNA_2 rRNA-23SrRNA_2 IGR214 IGR212 IGR216 IGR213 IGR217 IGR215 IGR211 TP0274 TP0276 parB, - TP0271 TP0267 TP0268 TP0273 pcnA, - TP0270 TP0269 TP0274 TP0276 parB, - TP0271 TP0267 TP0268 TP0273 pcnA, - TP0270 TP0269 Type: tandem, Name:  - 69 Type: tandem, Name:  - 70 Type: tandem, Name:  - 289 TP0274 parB, - TP0271 TP0275 parA, - TP0272 parA, - TP0272 TP0276 TP0275 TP0268 TP0273 pcnA, - TP0270 TP0269 TP0267
* Calculated from Protein Sequence

Gene ID: TP0270

DNA Molecule Name:
1  

Genbank ID:
3322543

Gene Name:
pcnA  

Definition:
polynucleotide adenylyltransferase

Gene Start:
286104

Gene Stop:
287537

Gene Length:
1434

Molecular Weight*:
53309

pI*:
8.02

Net Charge*:
7.69

EC:
2.7.7.19  

Functional Class:
Transcription; RNA processing  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is a polymerase that creates the 3' poly(A) tail found
in some mRNAs. It seems to be involved in plasmid copy number control

Reaction:
N ATP + (NUCLEOTIDE)(M) = N PYROPHOSPHATE + (NUCLEOTIDE)(M+N).

See TP0596, polynucleotide adenylyltransferase (pcnB).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to polynucleotide
adenylyltransferases. For example residues 9-466 are 30% similar to
polynucleotide adenylyltransferase, PcnA of Mycobacterium
tuberculosis, (Z94121).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class:  J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 18-86 are 52% similar to POLY(A) POLYMERASE of PAPS_BACSU.
Residues 106-175 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0596 polynucleotide
adenylyltransferase (pcnB). Residues 13-231 are 31% similar to
TP0596.

Pfam Summary:  Pfam Search
Residues 82 to 237 (E-value = 1.5e-77) place TP0270 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
119  
232
transmembrane  
268  
298

PDB Hit:
none

Gene Protein Sequence:
MRVFPVCPLLREVSERFIRAGFCIYVVGGAVRDFLLNRSAHDWDLATDAP
PERVRMLFRRTVPTGIEHGTVTILFRGHSIECTTFRVESDYSDRRHPDSV
CFAARIEDDLARRDFTVNAFAAALPSGEIIDVCGGYADLRNGLICSVGDA
HARFSEDALRPLRAVRFAAQLSFSIEARTREAIIALRAHTARISRERVRD
ELSKMLCTPRPSIALRLMEETGLLHTLFPALAQVCGRNEGEEKETQDSLQ
VSPQQRRDARTFAACAFAACDRVPAELAVRLAALLFPLAHYRTLPASGTG
AALFICPPALAEARELLRGLKYPNYLTAQVCHLVAHARFTPHECWSEGTL
RRFVVTVGTTQLESLCVLRRAYLADDDYRISAQPGVSCENAREGKKMQEQ
FEIFVTRVRRVAAQLPVHGIRDLAVNGRDLIAQGIPPGPTIGHILNALFD
MVLMQPSRNTRPQLLEHAQEIVRTMAQN

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGCGTGTTTCCTGTCTGTCCGCTGCTGCGTGAAGTGAGTGAGCGTTT
CATCCGTGCAGGATTTTGCATTTATGTTGTCGGGGGTGCTGTGCGTGACT
TTCTCCTGAACCGCAGTGCTCATGATTGGGATCTTGCAACTGACGCTCCC
CCTGAGCGTGTGCGTATGCTTTTTAGACGCACGGTTCCTACTGGTATTGA
ACACGGCACTGTTACAATTCTTTTCAGAGGGCATTCTATTGAGTGCACTA
CGTTCCGTGTTGAGTCGGATTATTCCGATAGGAGACATCCGGATTCTGTT
TGCTTTGCCGCGCGCATTGAGGACGATTTGGCAAGGCGCGACTTCACTGT
CAATGCTTTCGCTGCCGCGCTCCCCTCGGGGGAAATCATCGACGTATGTG
GCGGTTACGCCGATTTGCGTAACGGTCTTATCTGTAGCGTTGGGGATGCA
CATGCTAGATTTTCTGAAGATGCGTTGCGTCCTTTGCGTGCTGTGCGTTT
TGCAGCGCAGTTATCTTTTTCCATCGAAGCGCGCACGCGTGAAGCAATTA
TCGCGCTACGCGCTCATACTGCACGTATTTCTCGTGAGCGGGTGCGTGAT
GAACTTTCTAAGATGCTTTGTACTCCCCGTCCGAGTATTGCGCTCCGCCT
AATGGAAGAGACTGGATTGCTGCACACACTTTTTCCTGCGCTGGCGCAGG
TGTGTGGGAGAAACGAAGGGGAGGAGAAGGAGACGCAGGACAGTCTGCAG
GTTTCACCGCAGCAACGACGTGACGCTCGCACCTTTGCTGCGTGCGCGTT
TGCTGCGTGCGATCGGGTGCCTGCAGAGCTTGCGGTCCGCCTTGCAGCAC
TTCTCTTTCCGCTGGCTCACTATCGTACGCTTCCTGCTTCAGGAACGGGG
GCAGCGTTGTTTATATGCCCTCCTGCACTTGCTGAAGCGCGCGAGCTTTT
GCGTGGCCTGAAGTACCCGAATTACCTGACGGCTCAGGTGTGTCACTTGG
TTGCACACGCGCGTTTTACTCCACACGAATGTTGGTCTGAAGGAACGCTC
CGTCGTTTCGTTGTGACGGTAGGTACTACTCAGCTAGAATCGCTGTGTGT
CCTGCGGCGTGCCTATCTTGCTGATGACGATTACCGCATATCTGCTCAGC
CTGGAGTGTCCTGCGAGAATGCGCGGGAAGGAAAAAAAATGCAGGAACAG
TTTGAAATATTCGTAACACGCGTGCGCAGGGTCGCCGCACAATTGCCTGT
GCACGGCATACGCGACCTTGCGGTGAACGGACGCGACTTGATAGCGCAGG
GCATTCCCCCAGGTCCCACCATAGGGCACATCCTGAACGCACTGTTTGAT
ATGGTCCTCATGCAACCGTCGCGCAACACGCGTCCGCAGCTTTTGGAACA
TGCGCAGGAGATTGTGCGCACCATGGCGCAGAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy