Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-1 rRNA-16SrRNA_2 rRNA-23SrRNA_2 IGR208 IGR207 IGR210 IGR206 IGR209 IGR211 TP0260 braC, - TP0265 TP0266 deoC, - TP0264 TP0261 TP0263 TP0260 braC, - TP0265 TP0266 deoC, - TP0264 TP0261 TP0263 Type: tandem, Name:  - 238 TP0260 braC, - TP0265 TP0266 deoC, - TP0264 TP0261 TP0263 crp, - TP0262 crp, - TP0262
* Calculated from Protein Sequence

Gene ID: TP0264

DNA Molecule Name:
1  

Genbank ID:
3322535

Gene Name:
deoC  

Definition:
deoxyribose-phosphate aldolase

Gene Start:
275817

Gene Stop:
276470

Gene Length:
654

Molecular Weight*:
23455

pI*:
7.04

Net Charge*:
0.17

EC:
4.1.2.4  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Carbohydrate metabolism; Pentose phosphate cycle

Secondary Evidence:
Sukhodolets VV, Trenina MA.
[Study of RecA-independent homologous recombination and a chromosomal rearrangement in the Escherichia coli strain carrying an extended tandem duplication].
Genetika. 2002 Feb;38(2):171-81.
PMID: 11898608

Franzén B, Becker S, Mikkola R, Tidblad K, Tjernberg A, Birnbaum S.
Characterization of periplasmic Escherichia coli protein expression at high cell densities.
Electrophoresis. 20(4-5):790-7.
PMID: 10344249

Loechel S, Inamine JM, Hu PC.
Nucleotide sequence of the deoC gene of Mycoplasma pneumoniae.
Nucleic Acids Res. 1989 Jan;17(2):801.
PMID: 2492658

Comment:
Reaction:
2-DEOXY-D-RIBOSE 5-PHOSPHATE = D-GLYCERALDEHYDE 3-PHOSPHATE + ACETALDEHYDE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several siginficant hits to many deoxyribose-
phosphate aldolase proteins. For example residues 1-204 are 40% similar
to DEOC_BACSU, deoxyribose-phosphate aldolase of Bacillus subtilis,
(D45912).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0274
COG name: Deoxyribose-phosphate aldolase
Functional Class:? F
The phylogenetic pattern of COG0274 is --t--qvcebrh--gp-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 58-185 are 41% similar to DEOXYRIBOSE-PHOSPHATE ALDOLASE of
DEOC_BACSU. Residues 7-40 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 214 (E-value = 1.2e-116) place TP0264 in the DeoC family which is described as Deoxyribose-phosphate aldolase (PF01791)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
67  
155

PDB Hit:
none

Gene Protein Sequence:
MELNAYIDHTLLRPSASEAEVLRLCQEAQHYRFASVCVNPCHVALAAGAV
RGTAVRVCSVIGFPFGTHVTEVKCAEAQRALDDGAQELDMVVRIDKVCAG
EREVVEREIAQVAARCHARGAIVKVIVETALLDEMHIAFACSCVEAGHAD
FIKTSTGYASRGGTEGDIQCFKKYLKGETKIKASGGIRTRAQAQRFIELG
CARIGTSNGVAIMEERAS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACTCAATGCATATATTGACCACACGCTCTTAAGGCCCTCTGCGTC
TGAGGCCGAAGTGTTGCGTCTGTGCCAAGAGGCGCAGCACTATCGCTTCG
CGTCGGTATGTGTAAATCCTTGCCATGTGGCGTTAGCAGCAGGTGCGGTG
CGGGGGACGGCGGTGCGGGTGTGCAGCGTGATCGGTTTTCCCTTTGGTAC
GCACGTCACGGAGGTCAAGTGCGCTGAGGCGCAGCGTGCGTTGGACGATG
GGGCGCAAGAGTTGGATATGGTCGTCCGTATAGACAAGGTGTGCGCGGGA
GAAAGAGAGGTTGTAGAACGCGAAATTGCGCAGGTTGCAGCGCGGTGTCA
CGCGCGCGGGGCCATTGTAAAAGTGATCGTGGAAACCGCCCTCTTAGATG
AGATGCACATCGCGTTTGCGTGTTCCTGTGTGGAGGCAGGACACGCGGAT
TTTATCAAAACATCCACCGGCTACGCGTCGCGCGGGGGAACGGAAGGGGA
TATTCAGTGCTTTAAAAAATATCTGAAAGGTGAGACAAAGATAAAAGCCT
CAGGCGGCATCCGTACGCGCGCGCAGGCGCAGCGTTTTATCGAGCTTGGC
TGTGCACGGATTGGTACCAGCAATGGGGTGGCGATTATGGAAGAGCGTGC
CTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy