Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR201 IGR203 IGR204 IGR202 IGR206 IGR200 IGR205 IGR199 TP0258 TP0260 rpmE, - TP0255 TP0259 pgsA, - TP0256 TP0261 glpQ, - TP0257 rho, - TP0254 cutE, - TP0252 TP0258 TP0260 rpmE, - TP0255 TP0259 pgsA, - TP0256 TP0261 glpQ, - TP0257 rho, - TP0254 cutE, - TP0252 Type: tandem, Name:  - 67 Type: tandem, Name:  - 68 Type: tandem, Name:  - 238 TP0258 TP0260 rpmE, - TP0255 TP0259 pgsA, - TP0256 TP0261 glpQ, - TP0257 rho, - TP0254 cutE, - TP0252 TP0253 crp, - TP0262 TP0253 crp, - TP0262
* Calculated from Protein Sequence

Gene ID: TP0257

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glpQ  

Definition:
protein D, glycerophosphodiester phosphodiesterase

Gene Start:
268190

Gene Stop:
269257

Gene Length:
1068

Molecular Weight*:
41002

pI*:
9.86

Net Charge*:
10.04

EC:
3.1.4.46  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of complex lipids; Glycerolipid metabolism

Primary Evidence:
Shevchenko DV, Sellati TJ, Cox DL, Shevchenko OV, Robinson EJ, Radolf JD. 1999. Membrane topology and cellular location of the Treponema pallidum glycerophosphodiester phosphodiesterase (GlpQ)
ortholog. Infect Immun May;67(5):2266-76. Medline: 99242808.

Shevchenko DV, Akins DR, Robinson EJ, Li M, Shevchenko OV, Radolf JD. 1997. Identification of homologs for thioredoxin, peptidyl prolyl cis-trans isomerase, and glycerophosphodiester
phosphodiesterase in outer membrane fractions from Treponema pallidum, the syphilis spirochete. Infect Immun Oct;65(10):4179-89. Medline: 97461344.

Comment:
This protein hydrolyzes deacylated phospholipids to Glycerol-3-Phosphate
and the corresponding alcohols.

Reaction:
A GLYCEROPHOSPHODIESTER + H(2)O = AN ALCOHOL + SN-GLYCEROL 3-PHOSPHATE.

This protein has been previously described as glycerophosphodiester
phosphodiesterase of Treponema pallidum subsp. pallidum, (AF004286).

Cameron et al., Infect Immun 1998 Dec;66(12):5763-70, find this protein to be
a significantly immunoprotective antigen that should be considered for inclusion
in a vaccine cocktail. It is bifunctional, that is able to bind antibodies
and able to exert enzymatic activity. See also Stebeck et al., FEMS Microbiol. Lett. 154 (2), 303-310 (1997), who
suggest that this protein is involved in IgD binding (as in H.influenzae).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed, in addition to the identity of this sequence to
glycerophosphodiester phosphodiesterase of Treponema pallidum,
(AF004286), several hits to protein D glycerophosphodiester
phosphodiesterases. For example residues 15-350 are 54% similar to
Protein D, Glycerophosphodiester phosphodiesterase of Haemophilus
influenzae,(Z35659).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0584
COG name: Glycerophosphoryl diester phosphodiesterase
Functional Class:  C
The phylogenetic pattern of COG0584 is ----Y-v-EBRh--GP-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 82-350 are 56% similar to glycerophosphoryldiester
phosphodiesterase of GLPQ_HAEIN. Residues 30-81 support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 31 to 345 (E-value = 6.5e-94) place TP0257 in the GDPD family which is described as Glycerophosphoryl diester phosphodiesterase family (PF03009)

PDB Hit:
None

Gene Protein Sequence:
MRGTYCVTLWGGVFAALVAGCASERMIVAYRGAAGYVPEHTFASKVLAFA
QGADYLQQDVVLSKDNQLIVAQSHILDNMTDVAEKFPRRQRADGHFYVID
FTVEELSLLRATNSFYTRGKRHTPVYGQRFPLWKPGFRLHTFEEELQFIR
GLEQTTGKKIGIYSEIKVPWFHHQEGKDIAALTLALLKKYGYQSRSDLVY
VQTYDFNELKRIKRELLPKYEMNVKLIQRVAYTDQRETQEKDSRGKWINY
NYNWMFEPGGMQKIAKYADGVGPDWRMLIENEWSKVGAVRLSPMVSAIQD
AKLECHVHTVRKETLPSYARTMDEMFSILFKQTGANVVLTDFPDLGVKFL
GKPARY

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGGGAACATATTGTGTGACGCTTTGGGGGGGGGTGTTTGCGGCATT
GGTTGCAGGCTGTGCGTCCGAACGTATGATAGTTGCGTATCGGGGCGCTG
CAGGATATGTGCCCGAGCACACCTTTGCCTCGAAAGTTCTTGCTTTTGCA
CAAGGAGCAGATTACCTGCAGCAGGATGTCGTGCTTTCAAAGGATAATCA
GCTTATCGTAGCGCAAAGCCATATTCTGGATAATATGACTGACGTGGCAG
AAAAATTTCCACGCCGGCAGCGTGCGGATGGGCATTTCTATGTCATAGAT
TTTACGGTAGAAGAACTTTCCCTCCTCCGTGCAACCAATAGTTTCTATAC
GCGCGGTAAGCGACATACGCCGGTGTATGGCCAGCGCTTTCCTCTTTGGA
AGCCTGGTTTTAGGCTGCACACTTTTGAAGAGGAGTTGCAGTTTATCCGT
GGGTTGGAACAGACAACCGGGAAAAAGATTGGAATTTACTCTGAAATAAA
GGTGCCGTGGTTTCATCATCAGGAAGGAAAAGACATCGCAGCGCTTACCC
TCGCTCTGTTGAAAAAATACGGTTACCAAAGTCGATCGGATCTAGTGTAT
GTGCAAACGTATGATTTTAACGAGCTGAAGCGTATCAAACGAGAACTTTT
ACCAAAGTACGAAATGAACGTGAAGCTGATTCAGCGTGTTGCTTACACAG
ATCAACGTGAAACACAGGAGAAGGACTCGCGTGGGAAATGGATAAACTAC
AATTACAATTGGATGTTTGAGCCCGGTGGTATGCAGAAAATAGCAAAATA
TGCAGACGGCGTGGGTCCTGACTGGAGGATGCTCATAGAGAATGAATGGT
CGAAGGTGGGCGCTGTTCGCCTGAGTCCGATGGTTTCTGCAATCCAAGAT
GCGAAATTGGAATGTCATGTGCACACGGTACGGAAAGAAACACTGCCTAG
CTACGCGCGCACCATGGACGAGATGTTTTCCATTTTGTTCAAACAGACGG
GCGCAAACGTGGTGCTCACGGATTTTCCTGATCTTGGGGTAAAGTTTCTG
GGCAAACCCGCCCGCTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy