Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR201 IGR203 IGR204 IGR202 IGR206 IGR200 IGR205 IGR198 IGR199 TP0258 TP0260 rpmE, - TP0255 rpsT, - TP0250.1 TP0259 pgsA, - TP0256 TP0261 glpQ, - TP0257 rho, - TP0254 cutE, - TP0252 TP0258 TP0260 rpmE, - TP0255 rpsT, - TP0250.1 TP0259 pgsA, - TP0256 TP0261 glpQ, - TP0257 rho, - TP0254 cutE, - TP0252 Type: tandem, Name:  - 67 Type: tandem, Name:  - 68 Type: tandem, Name:  - 238 TP0258 TP0260 rpmE, - TP0255 TP0259 pgsA, - TP0256 TP0261 glpQ, - TP0257 rho, - TP0254 cutE, - TP0252 TP0250 dbh, - TP0251 TP0253 TP0253 rpsT, - TP0250.1 dbh, - TP0251 TP0250
* Calculated from Protein Sequence

Gene ID: TP0256

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgsA  

Definition:
phosphatidylglycerophosphate synthase (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase)

Gene Start:
267443

Gene Stop:
268090

Gene Length:
648

Molecular Weight*:
24624

pI*:
10.09

Net Charge*:
11.13

EC:
2.7.8.5  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of complex lipids; Glycerolipid metabolism

Comment:
PgsA catalyzes the committed step to the synthesis of the acidic
phospholipids.

Reaction:
CDP-DIACYLGLYCEROL + GLYCEROL-3-PHOSPHATE =
CMP + 3-(3-PHOSPHATIDYL)-GLYCEROL 1-PHOSPHATE.

This protein has been previously described as TpPGS, (U95744).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed significant hits to many pgp synthatase genes.
For example residues 2-167 are 30% similar to PGSA_BACSU (P46322).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 56-92 represent a significant (100%) hit to block BL00379,
CDP-alcohol phosphatidyltransferases proteins.

ProDom Summary:  Protein Domain Search
Residues 44-93 were 42% similar to phosphatidylglycerophosphate
synthetase of PGSA_BACSU. Residues 99-144 also matched pgs proteins
while residues 42-83 are weakly similar to phosphatidylserine synthases.

Paralogs:  Local Blast Search
This protein is weakly paralogous to TP0730, another phospholipid
biosynthesis protein. Residues 55-159 are 26% similar to TP0730.

Pfam Summary:  Pfam Search
Residues 46 to 192 (E-value = 2.2e-26) place TP0256 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
31
transmembrane  
35  
57
transmembrane  
80  
114
transmembrane  
139  
157
transmembrane  
171  
196

PDB Hit:
none

Gene Protein Sequence:
MRLSDFYTALRLALVLPFFALYHMSRWVVMYFPAANVGRVVSIASVLLFL
FIACTDFLDGYYARKSGKYSSFGKVFDPFADVIANVTVMLCLVADNFMPV
FLFLCILYREFGMMFLRMLACGEGHVVGAQRMGKLKTASYMGAVLFSLLL
KALYAFELAGADWYERMRAVGRLVYVVPVVLALASFFSYLKTFFPILKRV
CGRTRYPVCKTCREWD

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGCTTTCTGACTTTTATACTGCGCTGAGACTGGCGTTGGTTCTCCC
TTTCTTTGCACTCTATCATATGTCACGTTGGGTTGTTATGTACTTTCCTG
CTGCCAATGTGGGGCGTGTGGTGTCTATCGCGTCGGTGCTGCTTTTTCTT
TTCATTGCGTGCACTGATTTCCTCGACGGTTATTACGCGCGCAAGTCAGG
GAAGTATTCTAGTTTTGGGAAGGTTTTCGATCCCTTTGCTGATGTGATAG
CGAATGTAACTGTCATGCTTTGCCTCGTGGCAGACAACTTCATGCCGGTT
TTTCTTTTTCTGTGTATTTTGTATCGGGAATTTGGAATGATGTTCCTGAG
AATGCTTGCGTGTGGCGAAGGTCACGTAGTTGGTGCCCAGAGAATGGGAA
AGCTGAAAACAGCCTCGTATATGGGTGCGGTCCTTTTTTCGCTTCTTTTG
AAAGCATTGTACGCCTTTGAATTGGCTGGCGCGGATTGGTATGAGCGCAT
GCGTGCGGTTGGCCGCCTGGTGTACGTGGTGCCAGTGGTATTGGCTCTTG
CTTCTTTTTTTTCTTACTTGAAGACTTTTTTCCCCATTCTCAAGCGCGTG
TGTGGGCGTACCCGTTACCCTGTATGCAAGACATGTCGTGAATGGGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy