Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR201 IGR197 IGR194 IGR195 IGR196 IGR202 IGR200 IGR198 IGR199 rpmE, - TP0255 rpsT, - TP0250.1 TP0248 pgsA, - TP0256 flaA, - TP0249 glpQ, - TP0257 amiA, - TP0247 rho, - TP0254 cutE, - TP0252 TP0246 rpmE, - TP0255 rpsT, - TP0250.1 TP0248 pgsA, - TP0256 flaA, - TP0249 glpQ, - TP0257 amiA, - TP0247 rho, - TP0254 cutE, - TP0252 TP0246 Type: tandem, Name:  - 67 Type: tandem, Name:  - 68 rpmE, - TP0255 TP0248 pgsA, - TP0256 flaA, - TP0249 glpQ, - TP0257 amiA, - TP0247 rho, - TP0254 cutE, - TP0252 TP0246 TP0250 dbh, - TP0251 TP0253 TP0253 rpsT, - TP0250.1 dbh, - TP0251 TP0250
* Calculated from Protein Sequence

Gene ID: TP0252

DNA Molecule Name:
1  

Genbank ID:
3322520

Gene Name:
cutE  

Definition:
apolipoprotein N-acyltransferase

Gene Start:
263236

Gene Stop:
264873

Gene Length:
1638

Molecular Weight*:
61503

pI*:
8.45

Net Charge*:
12.32

EC:
2.3.1.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of complex lipids; Glycerolipid metabolism
Nucleotide metabolism; Aminosugars metabolism

Secondary Evidence:
Fukuda A, Matsuyama S, Hara T, Nakayama J, Nagasawa H, Tokuda H.
Aminoacylation of the N-terminal cysteine is essential for Lol-dependent release of lipoproteins from membranes but does not depend on lipoprotein sorting signals.
J Biol Chem. 2002 Nov;277(45):43512-8.
PMID: 12198129

Dailey FE, Macnab RM.
Effects of lipoprotein biogenesis mutations on flagellar assembly in Salmonella.
J Bacteriol. 2002 Feb;184(3):771-6.
PMID: 11790747

Comment:
This protein transfers the fatty acyl group on membrane lipoproteins.
In E.coli, it is an integral membrane protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the most hits to apolipoprotein N-acyltransferases
with additional hits to acid-inducible proteins. For example residues
112-527 were 25% similar to Apolipoprotein N-acyltransferase of
Escherichia coli, (D90705). Residues 29-516 are 25% similar to an
acid-inducible protein (act206) of Borrelia burgdorferi, (AE00113)

COGS Summary:  COGS Search
BeTs to 9 clades of COG0815
COG name: Apolipoprotein N-acyltransferase
Functional Class:? M
The phylogenetic pattern of COG0815 is -----qvce-Rhuj--oLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 314-330 represent a significant (97%) hit to block PR00549A,
HYPERGLYCEMIC HORMONE TYPE 2 SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 275-504 are 29% similar to APOLIPOPROTEIN N-ACYLTRANSFERASE
of LNT_ECOLI. Residues 112-180 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0417, also an apolipoprotein
N-acyltransferase. Residues 29-542 are 25% similar to TP0417.

Pfam Summary:  Pfam Search
Residues 234 to 438 (E-value = 7.8e-12) place TP0252 in the CN_hydrolase family which is described as Carbon-nitrogen hydrolase (PF00795)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
27
transmembrane  
40  
61
transmembrane  
65  
81
transmembrane  
85  
109
transmembrane  
154  
177
transmembrane  
199  
218
transmembrane  
517  
533

PDB Hit:
none

Gene Protein Sequence:
MRIEEWCRSRLGEFLLFVLAVSLFALSHPNPLLPRGCALLAYGALAPLFL
LVRWASGFAVVFWGGAYGAFSYGAFSYWLFVFHPVALCVVAGFSALFLAA
LCLALKAGGAFWQRRALLVQCLVWLGYEYAKTLGFLGFPYGVMGYSQWRV
LPLIQVASVFGVWVVSALVVFPSAWLASVLGQWVEESERNARAFLSAAYS
HWVSALVWVGLCGFCVCAAKAGWWPDCTAHTRAKVALVQPNGDPRRGGIE
SYRADFSTLTYLSDWALERYPDVDLVVWPETAFVPRIDWHYRYRHEQQSF
QLVCDLLDYVNAKNCPFIIGSDDAYKKRTKEGNWERVDYNAALLFIPGVN
VLPPSPQRYHKIKLVPFTEYFPYKRVFPWFYNFLEKQDARFWAQGSEFVV
FEARGLKFSVPICFEDAFGYITREFCARGASLLVNISNDSWAKSLSCQYQ
HLSMAVFRAIENRRALVRASTSGQTVAIAPDGRILDELQPFAPGVLVADV
PIVTCACGGYRYWGDALGVFFCVASLFILIAGGVRHMLRCRRGGWR

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGGATTGAGGAATGGTGTCGTTCCCGTCTGGGCGAGTTTTTGTTGTT
TGTTCTGGCGGTTTCCCTGTTCGCGCTCTCTCACCCTAACCCTCTGCTTC
CCAGAGGGTGTGCTCTCCTAGCGTATGGGGCGCTTGCTCCTCTCTTCCTT
TTGGTAAGGTGGGCCTCGGGTTTTGCGGTTGTGTTCTGGGGGGGTGCGTA
CGGCGCGTTCAGCTACGGTGCGTTTTCTTATTGGCTTTTTGTATTTCATC
CGGTGGCGTTGTGCGTAGTTGCCGGCTTCTCTGCGCTTTTTCTTGCGGCG
CTGTGTCTTGCGCTGAAGGCTGGTGGTGCATTTTGGCAGCGGCGGGCGCT
TCTCGTGCAGTGTCTTGTGTGGCTTGGGTATGAGTACGCGAAGACGCTTG
GTTTTCTTGGTTTCCCTTACGGGGTTATGGGTTATTCGCAATGGCGTGTA
CTGCCGCTTATCCAAGTTGCATCGGTCTTCGGTGTGTGGGTTGTTTCTGC
ATTGGTGGTTTTTCCTTCAGCGTGGCTCGCATCTGTCCTGGGGCAGTGGG
TTGAGGAAAGTGAAAGGAATGCTCGGGCGTTTTTGTCTGCCGCGTATAGC
CACTGGGTTTCGGCGCTGGTGTGGGTTGGTCTGTGTGGGTTTTGTGTATG
CGCGGCCAAGGCGGGATGGTGGCCGGATTGCACAGCTCACACGCGGGCAA
AGGTTGCGCTCGTTCAGCCTAATGGTGATCCGCGACGCGGCGGTATCGAG
TCATATCGGGCGGATTTTAGCACACTGACGTATCTTTCTGATTGGGCGCT
TGAGCGGTATCCAGATGTTGATTTGGTGGTGTGGCCGGAGACGGCTTTTG
TTCCTCGCATCGACTGGCACTATCGCTACCGGCACGAACAGCAGTCATTT
CAGTTAGTATGCGATTTGCTGGACTACGTGAACGCCAAGAACTGCCCGTT
TATTATCGGTAGTGACGACGCATATAAGAAGCGCACGAAGGAGGGGAATT
GGGAACGTGTTGATTACAATGCGGCGCTTCTTTTCATTCCTGGGGTGAAC
GTGCTTCCGCCGAGTCCGCAGCGGTACCATAAGATAAAGCTTGTTCCCTT
TACGGAGTACTTTCCGTACAAGCGGGTATTTCCCTGGTTTTACAACTTCT
TGGAAAAGCAGGATGCGCGCTTTTGGGCCCAGGGGAGTGAATTCGTTGTG
TTTGAGGCACGAGGGTTAAAGTTTTCTGTCCCGATTTGTTTCGAGGATGC
GTTTGGGTACATCACGCGTGAGTTCTGTGCGCGTGGTGCCTCTTTGCTCG
TCAATATTTCTAACGACAGTTGGGCAAAGAGTCTTTCCTGTCAGTATCAG
CACCTGAGTATGGCGGTGTTTCGCGCAATCGAAAACAGGAGGGCACTGGT
GCGTGCAAGTACGTCTGGCCAGACGGTTGCAATTGCGCCTGACGGGCGTA
TACTCGATGAACTACAGCCCTTTGCCCCGGGAGTTTTGGTGGCGGACGTT
CCGATTGTCACATGCGCATGCGGAGGCTACCGGTATTGGGGGGACGCGTT
GGGAGTCTTTTTTTGTGTGGCGTCCCTTTTTATATTGATTGCTGGTGGTG
TGCGCCATATGCTGAGATGCAGGAGGGGCGGGTGGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy