Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR197 IGR194 IGR195 IGR196 IGR193 IGR198 IGR199 rpsT, - TP0250.1 TP0248 flaA, - TP0249 amiA, - TP0247 cutE, - TP0252 TP0246 TP0245 rpsT, - TP0250.1 TP0248 flaA, - TP0249 amiA, - TP0247 cutE, - TP0252 TP0246 TP0245 Type: tandem, Name:  - 66 Type: tandem, Name:  - 288 TP0248 flaA, - TP0249 amiA, - TP0247 cutE, - TP0252 TP0246 TP0245 TP0250 dbh, - TP0251 TP0253 TP0253 rpsT, - TP0250.1 dbh, - TP0251 TP0250
* Calculated from Protein Sequence

Gene ID: TP0247

DNA Molecule Name:
1  

Genbank ID:
3322517

Gene Name:
amiA  

Definition:
N-acetylmuramoyl-L-alanine amidase

Gene Start:
259822

Gene Stop:
260892

Gene Length:
1071

Molecular Weight*:
39798

pI*:
9.84

Net Charge*:
9.03

EC:
3.5.1.28  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Metabolism of complex carbohydrates; Peptideglycan biosynthesis

Secondary Evidence:
Mesnage S, Fouet A.
Plasmid-encoded autolysin in Bacillus anthracis: modular structure and catalytic properties.
J Bacteriol. 2002 Jan;184(1):331-4.
PMID: 11741877

Heidrich C, Templin MF, Ursinus A, Merdanovic M, Berger J, Schwarz H, de Pedro MA, Höltje JV.
Involvement of N-acetylmuramyl-L-alanine amidases in cell separation and antibiotic-induced autolysis of Escherichia coli.
Mol Microbiol. 2001 Jul;41(1):167-78.
PMID: 11454209

Claverys JP, Grossiord B, Alloing G.
Is the Ami-AliA/B oligopeptide permease of Streptococcus pneumoniae involved in sensing environmental conditions?.
Res Microbiol. 151(6):457-63.
PMID: 10961459

Martin B, Alloing G, Boucraut C, Claverys JP.
The difficulty of cloning Streptococcus pneumoniae mal and ami loci in Escherichia coli: toxicity of malX and amiA gene products.
Gene. 1989 Aug;80(2):227-38.
PMID: 2684766

Comment:
This protein hydrolyses the link between N-acetylmuramoyl residues and
L-amino acid residues in certain bacterial cell-wall glycopeptides.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to N-acetylmuramoyl-
L-alanine amidases. For example residues 69-348 are 26% similar to
AMIA_ECOLI, N-acetylmuramoyl-L-alanine amidase homolog of Escherichia
coli, (X75413).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0860
COG name: N-acetylmuramoyl-L-alanine amidase
Functional Class:? M
The phylogenetic pattern of COG0860 is -----q-CEBRhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 128-188 are 36% similar to N-ACETYLMURAMOYL-L-ALANINE
AMIDASE of CWLD_BACSU, however the E value for this hit is low.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 201 to 345 (E-value = 2e-56) place TP0247 in the Amidase_3 family which is described as N-acetylmuramoyl-L-alanine amidase (PF01520)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
35

PDB Hit:
none

Gene Protein Sequence:
MHWYFDRVSRARGIMKFLRSCLIGGVFFFALCLSADEAFVSAMKLARTLN
VSVSWNPLSQTILFSKGERRVQCRVGQVLALLDGSEVLMIDPPVVKDAVV
YVSGGFAERLRKVFGYSSHQPEHRVGAVLIDPGHGGKDWGTKGSYREQGK
TVVVKEKDIALRASQNIYDLLTARYPDRKIIMTRKGDSYLTLEERVAMAN
GVKLGKYEAILYVSVHANFSWNTKASGFEVWYLPPEYRRSILDKNAASKE
VLPILNSMLEEEFTMESIMIARSIADGMQASVGAQSKNRGVKEEAWFVVR
NAKMPSVLVELGFVSNPVEARLLNDADYLKRCAQGIYNGLVSFITYFEGS
GGFTGPL

Gene Nucleotide Sequence:  Sequence Viewer
GTGCATTGGTACTTTGACAGGGTATCTCGAGCGAGGGGCATTATGAAGTT
TTTGCGTTCGTGTTTGATAGGTGGTGTTTTCTTTTTTGCACTGTGTCTTT
CTGCTGATGAAGCGTTTGTGTCTGCGATGAAGCTTGCGCGTACGTTGAAT
GTGTCGGTTAGTTGGAATCCGCTTTCGCAAACAATTTTATTTTCCAAAGG
TGAGCGACGAGTACAATGTCGGGTTGGGCAAGTGCTTGCACTATTGGATG
GTAGTGAGGTGCTGATGATTGATCCGCCGGTGGTAAAGGACGCGGTGGTG
TATGTAAGTGGAGGGTTTGCAGAGCGGCTAAGGAAAGTATTTGGGTATTC
TTCACATCAACCTGAGCATCGTGTGGGTGCGGTGCTCATAGACCCAGGAC
ATGGAGGAAAGGATTGGGGGACGAAGGGCTCGTACCGTGAGCAGGGTAAA
ACGGTGGTGGTGAAAGAAAAAGACATTGCGTTGCGTGCATCTCAAAATAT
CTATGACTTACTTACGGCGCGCTATCCGGATCGTAAAATCATTATGACGC
GGAAAGGGGATTCATATCTTACGCTTGAGGAGCGTGTGGCGATGGCAAAT
GGGGTAAAGCTAGGGAAGTACGAAGCGATCCTGTACGTGTCGGTGCATGC
GAATTTTTCATGGAATACAAAGGCTTCTGGGTTTGAGGTGTGGTACTTGC
CGCCTGAATATCGCAGGTCAATTCTTGATAAAAATGCGGCGTCCAAAGAG
GTGCTCCCGATCTTGAACTCGATGCTCGAAGAGGAATTCACAATGGAAAG
TATTATGATTGCGCGCAGTATCGCTGACGGAATGCAAGCAAGCGTCGGTG
CACAAAGTAAAAATCGTGGAGTAAAAGAGGAGGCCTGGTTTGTAGTACGG
AACGCGAAGATGCCAAGTGTTTTGGTGGAATTAGGCTTTGTGAGTAATCC
GGTAGAGGCGCGGTTGCTCAACGATGCGGACTACTTGAAAAGGTGCGCGC
AGGGAATCTACAATGGGCTTGTTTCTTTTATCACGTATTTTGAAGGTTCG
GGGGGATTTACCGGACCCTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy