Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR186 IGR184 IGR189 IGR185 IGR187 IGR188 secE, - TP0235 rplL, - TP0240 rplK, - TP0237 rplJ, - TP0239 nusG, - TP0236 rplA, - TP0238 rpoB, - TP0241 rpoC, - TP0242 secE, - TP0235 rplL, - TP0240 rplK, - TP0237 rplJ, - TP0239 nusG, - TP0236 rplA, - TP0238 rpoB, - TP0241 rpoC, - TP0242 Type: tandem, Name:  - 65 Type: tandem, Name:  - 237 rplL, - TP0240 rplK, - TP0237 rplJ, - TP0239 nusG, - TP0236 rplA, - TP0238 rpoB, - TP0241 rpoC, - TP0242 secE, - TP0235
* Calculated from Protein Sequence

Gene ID: TP0241

DNA Molecule Name:
1  

Genbank ID:
3322511

Gene Name:
rpoB  

Definition:
DNA-directed RNA polymerase beta subunit

Gene Start:
245585

Gene Stop:
249118

Gene Length:
3534

Molecular Weight*:
132448

pI*:
5.92

Net Charge*:
-15.90

EC:
2.7.7.6  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA into
RNA using the four ribonucleoside triphosphate substrates.

Reaction:
N NUCLEOSIDE TRIPHOSPHATE = N PYROPHOSPHATE + RNA(N).

See TP0212, rpoA.
See TP0242, rpoC.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to DNA-directed RNA
polymerase, beta subunits. For example residues 10-1173 are 62%
similar to DNA-directed RNA polymerase of Borrelia burgdorferi,
(AE001144).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0085
COG name: DNA-dependent RNA polymerase beta subunit (split gene in Mjan, Mthe, Aful)
Functional Class:  K
The phylogenetic pattern of COG0085 is AMTkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 143-155, 414-423, 519-542, 207-230, 633-662, 765-788, 931-968,
and 1039-1088 represent significant (100%) hits to blocks
BL01166A,B,C,D,E,F,G, RNA polymerases beta chain proteins.

ProDom Summary:  Protein Domain Search
Residues 396-550 are 76% similar to DNA-directed RNA polymerase, beta
subunit of RPOB_BORBU. Residues 144-231, 576-705, 719-760, 761-887,
767-824, 928-982, 964-981, 1039-1110, and 1111-1145 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 25 to 480 (E-value = 3.3e-25) place TP0241 in the RNA_pol_Rpb2_1 family which is described as RNA polymerase beta subunit (PF04563)
Residues 158 to 425 (E-value = 2e-12) place TP0241 in the RNA_pol_Rpb2_2 family which is described as RNA polymerase Rpb2, domain 2 (PF04561)
Residues 481 to 553 (E-value = 4.9e-43) place TP0241 in the RNA_pol_Rpb2_3 family which is described as RNA polymerase Rpb2, domain 3 (PF04565)
Residues 686 to 1078 (E-value = 2e-237) place TP0241 in the RNA_pol_Rpb2_6 family which is described as RNA polymerase Rpb2, domain 6 (PF00562)
Residues 1080 to 1156 (E-value = 2.8e-47) place TP0241 in the RNA_pol_Rpb2_7 family which is described as RNA polymerase Rpb2, domain 7 (PF04560)

PDB Hit:
none

Gene Protein Sequence:
MSARVCKTHRVYVGRDVRNFMDIPDLIEIQLRSYDTFLHGARNTPSGADT
LISGTREELGLEDVFKTTFPIESSTGDMTLEYQSYSLDEKNIKFSEAECK
QKGLTYAIPLKALVDLRFNNTGEIRRKDIYMGDIPKMTERGTFIINGAER
VVVSQIHRSPGVVFSHEKDKEGREVFSSRIIPYRGSWLEFEIDQKKDLIY
AKLDKKRRILGTVFLRALHYETREQIIEAFYAIEKTPVCQDRAEYELLTG
KILARSVTVENEQGETRVLYKAGEKIHPHVIDDLLQNGICEVYIINLEAE
GSLRSAVVINCLEREEMKFSKSGAQDELSREEALCIVYSALRPSDPMTMD
AAEKDLQTMFFSPRRYDLGRVGRYKLNKKFRSDSPTTECTLTLDDIVNTM
KFLIRMYSGDAQEDDIDHLGNRRIRSVGELMTNTLKTAFLRMERIAKERM
SSKETETIKPQDLISIKPIMAAIKEFFGASQLSQFMDQVNPLAELTHKRR
LNALGPGGLSRERAGFEVRDVHYTHYGRMCPIETPEGPNIGLIVSMANYA
RVNGYGFLEVPYVRVRDGVVTKEIEYLDAMDEDRYYIGQDSTAVGPDGVI
RVDHVSCRHRGDYSTRSPKDIQYMDVSPKQIISVSASLIPFLEHDDANRA
LMGSNMQRQGVPLIFPEPPRVGTGMEEKCAYDSGVLVKAKQDGTVAYVSS
EKIVVCSAAASGEEQEVVYPLLKYQRTNQDTCYHQRPIVHVGDRVQVGDA
LADGPATYRGELALGRNILVGFVPWNGYNYEDAILISHRVVKEDMFTSVH
IKEFSTEVRETKLGSERMTNDIPNKSEKNLDNLDAEGIIRIGSKVRAGDV
LIGKITPKSESETTPEFRLLNSIFGEKAKEVRDSSLRVPHGVEGTVIDVQ
RLRRSEGDDLNPGVSEVVKVLIATKRKLREGDKMAGRHGNKGIVARILPE
EDMPYLDDGTPLDVCLNPLGVPSRMNIGQILESELGLAGLRLDEWYESPV
FQSPSNEQIGEKLMQAGFPTNSKVMLRDGRTGDYFQNPVFVGVIYFMKLA
HLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRLGEMEVWALEAYGAANT
LQELLTIKSDDMHGRSKIYEAIVKGEASSPTGIPESFNVLVQELRGLALD
FTIYDAKGKQIPLTERDEEMTNKIGSKF

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGCACGAGTTTGCAAAACACACAGAGTGTACGTGGGAAGGGATGT
CAGGAATTTTATGGACATCCCGGATCTCATCGAAATCCAGCTTCGATCTT
ACGACACCTTTCTGCATGGGGCCCGGAATACACCGTCCGGCGCCGACACC
CTTATCTCCGGTACTAGAGAGGAGCTCGGCCTCGAAGACGTGTTCAAGAC
TACCTTTCCTATCGAGAGCTCTACGGGGGACATGACGCTCGAGTACCAAT
CATACTCCCTTGATGAGAAAAACATCAAGTTCTCCGAGGCGGAGTGTAAA
CAAAAGGGTTTGACGTACGCCATTCCGCTGAAGGCGCTTGTTGATTTACG
TTTCAATAATACGGGGGAGATTAGGCGCAAAGACATTTATATGGGAGATA
TCCCCAAGATGACTGAACGCGGCACCTTTATCATCAACGGTGCGGAGCGT
GTGGTGGTATCCCAGATCCATCGTTCCCCTGGTGTTGTCTTTTCTCATGA
GAAGGACAAGGAAGGACGGGAGGTATTCTCCAGCCGCATTATTCCGTACC
GGGGAAGCTGGCTTGAATTTGAAATTGATCAGAAAAAAGATCTCATCTAT
GCAAAGCTTGATAAAAAGAGACGTATCCTAGGCACCGTGTTTTTGCGTGC
GTTGCACTACGAAACGCGTGAGCAGATCATCGAGGCCTTTTACGCCATAG
AAAAGACGCCTGTTTGTCAGGATCGTGCGGAGTACGAGCTGCTCACAGGT
AAGATCCTAGCACGATCGGTGACGGTGGAAAATGAGCAGGGTGAAACCCG
GGTGTTGTACAAAGCAGGAGAGAAAATCCATCCCCATGTCATCGATGATC
TGCTGCAAAACGGCATATGTGAGGTCTACATTATTAACCTTGAAGCGGAA
GGTTCGTTGCGTTCTGCGGTCGTTATCAATTGTCTTGAACGAGAGGAAAT
GAAGTTCTCTAAGTCGGGTGCACAGGACGAGCTTTCGCGTGAAGAGGCAC
TGTGTATTGTATACTCAGCGCTAAGACCAAGCGATCCTATGACCATGGAC
GCGGCGGAAAAAGATTTGCAGACAATGTTTTTCTCCCCACGTCGCTATGA
TTTAGGGCGGGTGGGGCGCTACAAGCTGAACAAGAAATTTCGCTCTGACT
CGCCGACTACTGAGTGCACGCTCACCCTCGATGATATCGTAAATACCATG
AAATTTCTCATCAGAATGTATAGCGGTGATGCACAGGAAGATGATATCGA
TCACCTGGGCAACCGTCGTATTCGTTCGGTGGGGGAATTAATGACCAATA
CGTTAAAAACGGCCTTTTTGCGCATGGAACGTATTGCGAAGGAGCGTATG
AGTTCTAAGGAAACGGAAACGATCAAGCCGCAGGATCTCATTTCCATAAA
ACCTATCATGGCTGCGATTAAGGAGTTCTTTGGTGCAAGTCAGCTTTCTC
AGTTCATGGATCAGGTCAATCCGCTGGCGGAGTTGACACACAAGCGGCGT
TTGAACGCACTTGGTCCTGGTGGACTTTCAAGGGAGCGTGCTGGGTTTGA
GGTACGCGATGTGCACTACACGCACTACGGTCGGATGTGTCCCATTGAGA
CCCCCGAAGGACCAAATATCGGTTTAATTGTTTCTATGGCCAATTACGCA
CGCGTTAACGGGTATGGGTTCTTGGAGGTGCCGTATGTACGGGTGCGTGA
CGGAGTTGTTACGAAAGAGATTGAGTACCTGGATGCTATGGACGAGGATC
GCTACTACATTGGGCAGGATTCTACGGCGGTAGGACCGGACGGGGTCATC
CGTGTAGATCATGTCTCTTGTCGGCACCGGGGGGATTACAGTACGCGTAG
TCCTAAGGATATCCAGTATATGGATGTTTCCCCCAAGCAGATAATTTCTG
TTTCTGCTTCTCTCATACCGTTTCTTGAGCATGATGATGCTAACCGTGCG
TTAATGGGGTCGAACATGCAACGGCAGGGAGTGCCGCTTATTTTTCCTGA
ACCCCCGCGCGTGGGTACAGGCATGGAAGAGAAGTGTGCATATGACTCTG
GAGTGCTGGTGAAGGCAAAGCAAGACGGAACGGTTGCCTACGTTTCCTCA
GAGAAGATAGTGGTTTGTTCCGCCGCGGCGTCTGGGGAAGAGCAGGAGGT
CGTGTATCCGTTACTTAAGTATCAGCGGACAAATCAGGATACCTGTTACC
ACCAGCGGCCAATAGTGCACGTGGGAGATCGGGTACAGGTAGGAGATGCG
CTTGCAGACGGTCCTGCAACGTATCGAGGGGAGCTTGCGCTTGGCAGAAA
CATTCTAGTTGGTTTTGTGCCGTGGAACGGTTACAACTACGAGGATGCCA
TTTTGATTTCTCACCGGGTGGTAAAGGAGGATATGTTCACCTCGGTTCAC
ATCAAAGAATTTTCTACTGAGGTGCGTGAAACCAAGCTGGGTTCTGAACG
AATGACGAATGATATCCCGAATAAGTCTGAGAAGAATCTGGATAATTTGG
ATGCAGAGGGGATCATTCGTATTGGGTCAAAGGTGCGTGCGGGAGACGTG
CTTATCGGAAAGATTACGCCAAAAAGCGAGTCTGAGACGACGCCAGAGTT
TAGGCTGCTGAATTCTATTTTTGGGGAGAAGGCGAAGGAAGTGCGTGATT
CTTCTCTACGTGTGCCGCATGGAGTTGAGGGTACAGTCATTGACGTGCAG
CGACTCAGGCGTTCGGAGGGAGATGATTTAAACCCCGGGGTGTCAGAGGT
GGTGAAGGTTCTTATCGCTACCAAGCGTAAGCTGCGTGAAGGGGATAAAA
TGGCCGGTCGCCACGGTAACAAGGGTATCGTTGCGCGCATCCTTCCTGAA
GAAGACATGCCGTATCTGGATGATGGTACCCCGCTTGATGTCTGTTTGAA
CCCGCTCGGTGTACCTTCTCGTATGAACATAGGACAGATTCTTGAATCTG
AATTGGGACTTGCGGGGTTGCGGCTTGACGAATGGTATGAGTCTCCTGTC
TTTCAATCTCCAAGCAACGAGCAGATTGGGGAAAAGTTGATGCAGGCAGG
TTTTCCGACTAATTCAAAAGTGATGCTGCGTGACGGACGCACGGGGGATT
ATTTTCAAAACCCTGTATTTGTGGGGGTTATTTACTTTATGAAGCTTGCG
CATCTAGTGGATGACAAAATGCACGCCCGCTCTACAGGTCCATATTCGCT
TGTGACGCAGCAACCCTTAGGGGGTAAAGCGCAGTTTGGAGGGCAGCGTC
TCGGGGAAATGGAGGTGTGGGCGCTTGAAGCCTACGGCGCGGCGAATACC
CTGCAGGAGTTGCTAACGATTAAATCGGATGATATGCACGGGCGTTCTAA
AATTTATGAGGCAATTGTAAAAGGGGAGGCTTCGTCTCCTACCGGTATTC
CTGAATCTTTTAACGTGTTGGTGCAGGAGCTGCGGGGACTTGCGCTCGAC
TTTACGATTTACGATGCGAAGGGCAAGCAGATTCCGCTCACTGAGCGCGA
TGAAGAAATGACGAATAAGATTGGCTCTAAATTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy