Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 rRNA-5SrRNA_1 rRNA-23SrRNA_1 IGR178 IGR181 IGR176 IGR177 IGR180 IGR179 IGR182 IGR175 TP0226 TP0227 bioY, - TP0228 TP0232 rpmG, - TP0234 spoIIAA, - TP0233 TP0231 TP0229 priA, - TP0230 TP0226 TP0227 bioY, - TP0228 TP0232 rpmG, - TP0234 spoIIAA, - TP0233 TP0231 TP0229 priA, - TP0230 Type: tandem, Name:  - 64 TP0226 TP0227 bioY, - TP0228 spoIIAA, - TP0233 TP0231 TP0229 priA, - TP0230 TP0232 rpmG, - TP0234
* Calculated from Protein Sequence

Gene ID: TP0228

DNA Molecule Name:
1  

Genbank ID:
3322497

Gene Name:
bioY  

Definition:
probable biotin synthase

Gene Start:
237457

Gene Stop:
236645

Gene Length:
813

Molecular Weight*:
28759

pI*:
11.20

Net Charge*:
15.73

EC:
6.3.4.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Rodionov DA, Mironov AA, Gelfand MS.
Conservation of the biotin regulon and the BirA regulatory signal in Eubacteria and Archaea.
Genome Res. 2002 Oct;12(10):1507-16.
PMID: 12368242

Comment:
BioY is involved in bioconversion of pimelate into dethiobiotin.

This protein may have an extra N-terminal region (~70-120 aa).

Blast Summary:  PSI-Blast Search
Gapped BLAST and PSI-BLAST revealed significant hits to biotin synthase
proteins. For example residues 105-228 are 35% similar to BIOY_BACSH
bioY protein of Bacillus sphaericus,(M29292). In addition there are
several significant hits to hypothetical proteins. For example residues
108-226 are 33% similar to conserved hypothetical protein of
Archaeoglobus fulgidus,(AE001023).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1268
COG name: Uncharacterized ACR, BioY family
Functional Class:? R
The phylogenetic pattern of COG1268 is a-tk--vc-B-------li-x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 105-225 are 38% similar to BIOY PROTEIN PRECURSOR of
BIOY_BACSH.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 102 to 263 (E-value = 7.9e-78) place TP0228 in the BioY family which is described as BioY family (PF02632)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
86  
106
transmembrane  
108  
127
transmembrane  
130  
151
transmembrane  
159  
180
transmembrane  
197  
226
transmembrane  
232  
258

PDB Hit:
none

Gene Protein Sequence:
MHRTEPTINCVHDGTRSLHLSIDTTRALPAHSGNEPTRTHLAAVRVSLLK
TIPVAPPKILKDSSFRVTLRIDPSEEYCTMHRSKSLAFVALFAALISSSA
LVSIPLKPVPLVLQNAAAVLTGLLLGPRDGALAVLSFLGAGLLGLPVFSG
GRGGYTALFAPTGGFLLGYILAATLAGAIAQHHRLSCTPPRGGGRALLLW
IRLTVATLVGFLSIYSIGLPVLGYVLGLRTGELMLGVFLPFFLADTLKIA
LVVLLAHHLAPTVRRHLYRHG

Gene Nucleotide Sequence:  Sequence Viewer
GTGCATAGGACTGAGCCTACCATAAACTGCGTACATGACGGTACCCGATC
CTTGCATCTGTCAATAGACACTACACGAGCTCTGCCCGCGCACAGTGGGA
ACGAACCGACGCGTACGCACCTGGCAGCCGTTCGGGTAAGTCTGTTAAAA
ACTATACCTGTGGCACCACCCAAGATATTGAAAGATTCCTCCTTCCGTGT
CACACTGCGCATCGACCCTTCGGAGGAGTACTGTACCATGCACCGTAGTA
AGTCTTTGGCTTTTGTTGCGCTTTTTGCCGCACTCATTAGCTCGAGTGCG
CTCGTTAGCATTCCTCTCAAGCCTGTTCCGCTTGTACTGCAGAATGCAGC
GGCCGTTCTCACCGGTTTATTGTTGGGACCGCGAGACGGTGCACTCGCCG
TTCTCAGCTTCCTCGGGGCAGGACTCCTTGGTCTGCCGGTTTTTTCAGGA
GGTCGGGGCGGATACACCGCGCTTTTTGCCCCTACGGGAGGATTCCTCCT
TGGATACATACTCGCTGCTACGCTCGCTGGCGCAATCGCGCAGCACCACC
GCCTGTCTTGCACTCCACCACGCGGTGGTGGACGCGCACTCCTTCTTTGG
ATCAGACTTACCGTCGCAACGCTCGTTGGTTTTCTTTCGATTTACTCCAT
CGGTCTGCCGGTTCTCGGTTACGTGCTTGGCCTCAGGACCGGGGAGCTCA
TGCTAGGAGTCTTCCTTCCCTTTTTTCTTGCCGACACCCTGAAAATCGCC
CTTGTTGTCCTACTCGCCCATCATCTTGCCCCTACAGTTCGCCGCCATTT
GTACCGTCATGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy