Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ile-1 rRNA-16SrRNA_1 rRNA-23SrRNA_1 IGR170 IGR171 IGR169 IGR173 IGR174 IGR172 IGR175 TP0224 spoIIAA, - TP0220 TP0222 TpLRR, - TP0225 TP0221 aat, - TP0223 rsbU, - TP0219 TP0224 spoIIAA, - TP0220 TP0222 TpLRR, - TP0225 TP0221 aat, - TP0223 rsbU, - TP0219 Type: tandem, Name:  - 62 Type: tandem, Name:  - 63 Type: tandem, Name:  - 287 TP0222 TpLRR, - TP0225 TP0221 aat, - TP0223 rsbU, - TP0219 TP0224 spoIIAA, - TP0220
* Calculated from Protein Sequence

Gene ID: TP0224

DNA Molecule Name:
1  

Genbank ID:
3322499

Gene Name:


Definition:
hypothetical protein (basic)

Gene Start:
229027

Gene Stop:
229128

Gene Length:
102

Molecular Weight*:
3812

pI*:
10.36

Net Charge*:
3.17

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. Residues 10-29 are 45% identical to a stretch of hypothetical protein from M.jannaschii (U67597).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MRISAGVLNFLKVDLFKGVRHACAPLVWDAYPLK

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGCATATCTGCGGGAGTGCTTAATTTTTTAAAAGTTGACCTTTTCAA
GGGGGTTCGTCATGCTTGCGCACCGCTTGTGTGGGACGCGTATCCATTGA
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy