Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap rRNA-16SrRNA_1 IGR170 IGR168 IGR171 IGR169 IGR173 IGR174 IGR167 IGR172 IGR175 TP0224 spoIIAA, - TP0220 TP0222 TpLRR, - TP0225 TP0221 TP0217 aat, - TP0223 rsbU, - TP0218 rsbU, - TP0219 TP0224 spoIIAA, - TP0220 TP0222 TpLRR, - TP0225 TP0221 TP0217 aat, - TP0223 rsbU, - TP0218 rsbU, - TP0219 Type: tandem, Name:  - 63 Type: tandem, Name:  - 60 Type: tandem, Name:  - 61 Type: tandem, Name:  - 62 Type: tandem, Name:  - 287 TP0222 TpLRR, - TP0225 TP0221 TP0217 aat, - TP0223 rsbU, - TP0218 rsbU, - TP0219 TP0224 spoIIAA, - TP0220
* Calculated from Protein Sequence

Gene ID: TP0221

DNA Molecule Name:
1  

Genbank ID:
3322488

Gene Name:


Definition:
carboxypeptidase

Gene Start:
226177

Gene Stop:
226956

Gene Length:
780

Molecular Weight*:
29179

pI*:
8.86

Net Charge*:
12.30

EC:
3.4.-.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Miscellaneous Enzymes

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST and PSI blast revealed several significant hits to
carboxypeptidases. For example residues 57-257 are 36% similar to
putative carboxypeptidase of Borrelia burgdorferi, (AE001159).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1876
COG name: D-alanyl-D-alanine carboxypeptidase
Functional Class:  M
The phylogenetic pattern of COG1876 is -------C-b------ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 34-45, 24-75, 15-66, 3-54, 11-62, and 9-60 represent significant
hits to blocks BL00222A,B, Insulin-like growth factor binding proteins.

ProDom Summary:  Protein Domain Search
Residues 69-255 are 29% similar to D,D-carboxypeptidase of VANY_ENTFC.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 106 to 246 (E-value = 6.1e-80) place TP0221 in the VanY family which is described as D-alanyl-D-alanine carboxypeptidase (PF02557)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
56

PDB Hit:
none

Gene Protein Sequence:
MARWNCVCVCRVRVSCSGKCGLAAGRGSGGSASCACCCEARGASCAPCTR
LCAQGREFLQELDAVLTTEGYLLRLVDKKHPLPETFVPKHLVPVREQWLF
FSKGRSLLLTKIAYEALHQLIQAAARDGVALSVGSAYRSFAYQKKLFSWY
AQEHGMQEAMRFSAREGTSQHQLGTVVDFGSITPAFARSDAGRWTQRNAH
RFGWSLSFPPGYEQVTGYVWEPWHFRYVGVRACALQKKWFEDIQQYMLGF
IHEWKVNASS

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCGCGTTGGAACTGCGTGTGCGTATGCAGGGTACGTGTTAGTTGCTC
TGGGAAATGCGGTCTCGCCGCAGGGCGTGGATCGGGTGGATCTGCATCGT
GTGCGTGCTGCTGCGAAGCGCGCGGCGCTTCCTGCGCGCCTTGTACGCGT
TTGTGTGCACAGGGGAGGGAGTTTTTGCAAGAGCTCGACGCGGTACTTAC
CACGGAGGGGTATCTGTTGCGTTTGGTTGACAAGAAACATCCCCTGCCAG
AAACGTTCGTGCCGAAGCATCTGGTGCCGGTGCGTGAGCAGTGGCTCTTT
TTTTCAAAGGGGAGGTCGCTCCTTTTAACTAAGATTGCGTACGAAGCGTT
ACATCAGCTGATTCAGGCGGCTGCGCGTGACGGGGTGGCACTGTCCGTTG
GTTCTGCCTATCGCTCTTTTGCGTATCAGAAAAAGTTGTTCTCCTGGTAT
GCGCAGGAGCATGGCATGCAGGAGGCTATGCGTTTTTCCGCGCGAGAAGG
AACAAGTCAGCACCAGTTGGGGACGGTAGTGGATTTCGGTTCTATCACGC
CGGCGTTTGCACGGAGTGATGCAGGGAGGTGGACGCAGCGCAACGCCCAT
CGTTTTGGATGGTCGCTGTCTTTTCCCCCTGGTTACGAGCAGGTGACGGG
GTATGTATGGGAGCCGTGGCATTTCCGTTATGTAGGGGTGCGTGCGTGCG
CACTCCAAAAGAAGTGGTTTGAGGATATCCAGCAATACATGCTTGGATTT
ATTCATGAATGGAAGGTGAACGCATCGTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy