Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR159 IGR158 IGR155 IGR156 IGR154 IGR162 IGR160 IGR161 IGR163 IGR165 IGR166 IGR157 IGR164 rpmJ, - TP0209 rpmD, - TP0206.1 TP0214 rplR, - TP0205 rpsM, - TP0210 rpsK, - TP0211 rpsH, - TP0203 rplO, - TP0207 rpsE, - TP0206 rplF, - TP0204 grpE, - TP0215 rpoA, - TP0212 TP0217 secY, - TP0208 dnaK, - TP0216 rpmJ, - TP0209 rpmD, - TP0206.1 TP0214 rplR, - TP0205 rpsM, - TP0210 rpsK, - TP0211 rpsH, - TP0203 rplO, - TP0207 rpsE, - TP0206 rplF, - TP0204 grpE, - TP0215 rpoA, - TP0212 TP0217 secY, - TP0208 dnaK, - TP0216 Type: tandem, Name:  - 58 Type: tandem, Name:  - 59 rpmJ, - TP0209 rplR, - TP0205 rpsK, - TP0211 rplO, - TP0207 rpsE, - TP0206 rplF, - TP0204 grpE, - TP0215 rpoA, - TP0212 TP0217 secY, - TP0208 dnaK, - TP0216 rplQ, - TP0213 TP0214 rpmD, - TP0206.1 rpsM, - TP0210 rpsH, - TP0203 rplQ, - TP0213
* Calculated from Protein Sequence

Gene ID: TP0212

DNA Molecule Name:
1  

Genbank ID:
3322481

Gene Name:
rpoA  

Definition:
DNA-directed RNA polymerase alpha subunit

Gene Start:
216003

Gene Stop:
217055

Gene Length:
1053

Molecular Weight*:
39532

pI*:
4.84

Net Charge*:
-14.46

EC:
2.7.7.6  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Secondary Evidence:
Nakasone K, Ikegami A, Fujii S, Kato C, Horikoshi K.
Isolation and piezoresponse of the rpoA gene encoding the RNA polymerase alpha subunit from the deep-sea piezophilic bacterium Shewanella violacea.
FEMS Microbiol Lett. 2000 Dec;193(2):261-8.
PMID: 11111034

Williams SM, Savery NJ, Busby SJ, Wing HJ.
Transcription activation at class I FNR-dependent promoters: identification of the activating surface of FNR and the corresponding contact site in the C-terminal domain of the RNA polymerase alpha subunit.
Nucleic Acids Res. 1997 Oct;25(20):4028-34.
PMID: 9321653

Sharif TR, Igo MM.
Mutations in the alpha subunit of RNA polymerase that affect the regulation of porin gene transcription in Escherichia coli K-12.
J Bacteriol. 1993 Sep;175(17):5460-8.
PMID: 8396118

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA into
RNA using the four ribonucleoside triphosphate substrates.

See TP0241, rpoB.
See TP0242, rpoC.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to DNA-directed RNA
polymerase, alpha subunit proteins. For example residues 7-346 are
38% similar to DNA-directed RNA polymerase of Borrelia burgdorferi,
(AE001152).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0202
COG name: DNA-dependent RNA polymerase alpha subunit
Functional Class:? K
The phylogenetic pattern of COG0202 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 29-321 are 36% similar to DNA-directed RNA polymerase, alpha
subunit of RPOA_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 21 to 243 (E-value = 1.5e-20) place TP0212 in the RNA_pol_L family which is described as RNA polymerase Rpb3/Rpb11 dimerisation domain (PF01193)
Residues 74 to 188 (E-value = 1.6e-15) place TP0212 in the RNA_pol_A_bac family which is described as RNA polymerase Rpb3/RpoA insert domain (PF01000)
Residues 255 to 322 (E-value = 1.7e-12) place TP0212 in the RNA_pol_A_CTD family which is described as Bacterial RNA polymerase, alpha chain C terminal domain (PF03118)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
213  
295

PDB Hit:
gi|1421046|pdb|1COO| The Cooh-Terminal Domain Of Rna Polymerase Alpha Subunit Transcription Regulation Mol_id: 1; Molecule: Rna Polymerase Alpha Subunit; Chain: Null; Fragment: Cooh-Terminal Domain; Engineered: Yes

Gene Protein Sequence:
MPRRNLLKGFKRPKVLEFLSENSSECYGKFTASPFETGFGTTVGNCLRRV
LLSSIQGYAVTGVRITSFDADGVAHFISSEFEQIPHVREDTLEILNNFKR
LRFLLPQGAESSTFTYEFRGAVSLTGKDFAKKFQLEVLSQDLLIMEMMDG
AHVEVELHVEFGRGYVPAESHDRYADLVGVIPVDAIFSPVLRVRYDIQSC
RVGQRGDYDQLSLEVWTDGTVRPEDAIAEAAKIIKEHFTVFVNFDETALD
LEDEPEEDDPAVLELLNTKIADVDFSVRARNCLLTMGIKTLGELTRISEQ
TLANTRNVGKKSLSEIQGKLQEYNLRLGMADYNHVGVVSRLMRQKEEIDE
A

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTCGTAGAAATCTTTTGAAGGGTTTTAAAAGACCTAAGGTGCTGGA
GTTTCTTTCGGAGAACTCAAGCGAGTGTTATGGGAAGTTCACCGCCTCTC
CTTTTGAGACTGGTTTTGGCACCACTGTTGGTAACTGTTTGCGGCGCGTC
TTACTCTCTTCTATCCAGGGGTATGCGGTCACCGGGGTTCGCATCACGTC
CTTTGATGCGGACGGGGTTGCGCACTTCATTTCAAGCGAGTTTGAACAGA
TTCCCCACGTACGGGAAGATACCCTCGAGATTCTAAATAATTTTAAGCGT
CTGCGTTTTCTCCTGCCGCAGGGGGCAGAGTCTAGTACGTTCACGTATGA
GTTTCGCGGCGCGGTGTCTTTGACGGGGAAGGACTTTGCTAAGAAGTTTC
AACTCGAGGTTCTGTCTCAAGACCTGCTCATCATGGAAATGATGGACGGT
GCGCATGTTGAAGTAGAGCTACACGTCGAATTCGGGCGTGGGTATGTACC
TGCTGAATCGCACGATCGGTATGCCGATTTAGTTGGGGTTATCCCTGTTG
ACGCAATTTTTAGTCCCGTGTTGAGAGTCCGCTATGATATTCAGTCTTGC
CGTGTAGGTCAGCGGGGGGATTACGATCAGTTATCCCTTGAAGTGTGGAC
AGATGGTACGGTGCGTCCCGAAGACGCGATAGCCGAGGCAGCGAAAATTA
TCAAGGAGCACTTTACAGTTTTTGTTAATTTTGACGAGACCGCGCTCGAC
CTGGAGGACGAGCCAGAAGAGGATGACCCTGCCGTTCTGGAGCTGTTGAA
CACGAAAATCGCTGATGTAGATTTTTCAGTGCGCGCGCGTAACTGCCTTT
TAACTATGGGAATCAAGACGCTGGGGGAGTTGACAAGGATTTCTGAGCAG
ACACTTGCGAATACGCGTAATGTGGGTAAGAAAAGTTTAAGTGAGATACA
GGGCAAGTTGCAGGAATATAACTTGCGTCTGGGTATGGCTGACTACAACC
ATGTGGGGGTTGTTAGTAGACTGATGCGACAGAAGGAAGAAATAGATGAG
GCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy