Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR137 IGR136 IGR143 IGR142 IGR139 IGR144 IGR140 IGR141 IGR138 smpB, - TP0184 TP0183 TP0179 rpsJ, - TP0188 rplC, - TP0189 rplD, - TP0190 sip, - TP0185 TP0182 rplB, - TP0192 hemN, - TP0186 tuf, - TP0187 smpB, - TP0184 TP0183 TP0179 rpsJ, - TP0188 rplC, - TP0189 rplD, - TP0190 sip, - TP0185 TP0182 rplB, - TP0192 hemN, - TP0186 tuf, - TP0187 Type: tandem, Name:  - 56 smpB, - TP0184 TP0183 TP0179 TP0180 TP0180 rpsJ, - TP0188 rplC, - TP0189 rplD, - TP0190 sip, - TP0185 rplB, - TP0192 hemN, - TP0186 tuf, - TP0187 rplW, - TP0191 TP0181 rplW, - TP0191 TP0182 TP0181
* Calculated from Protein Sequence

Gene ID: TP0186

DNA Molecule Name:
1  

Genbank ID:
3322450

Gene Name:
hemN  

Definition:
oxygen-independent coproporphyrinogen III oxidase

Gene Start:
201837

Gene Stop:
203015

Gene Length:
1179

Molecular Weight*:
44093

pI*:
7.98

Net Charge*:
6.54

EC:
1.-.-.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme and porphyrin  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Layer G, Verf├╝rth K, Mahlitz E, Jahn D.
Oxygen-independent coproporphyrinogen-III oxidase HemN from Escherichia coli.
J Biol Chem. 2002 Sep;277(37):34136-42.
PMID: 12114526

Homuth G, Rompf A, Schumann W, Jahn D.
Transcriptional control of Bacillus subtilis hemN and hemZ.
J Bacteriol. 1999 Oct;181(19):5922-9.
PMID: 10498703

Lieb C, Siddiqui RA, Hippler B, Jahn D, Friedrich B.
The Alcaligenes eutrophus hemN gene encoding the oxygen-independent coproporphyrinogen III oxidase, is required for heme biosynthesis during anaerobic growth.
Arch Microbiol. 1998 Jan;169(1):52-60.
PMID: 9396835

Hippler B, Homuth G, Hoffmann T, Hungerer C, Schumann W, Jahn D.
Characterization of Bacillus subtilis hemN.
J Bacteriol. 1997 Nov;179(22):7181-5.
PMID: 9371469

Comment:
Coproporphyrinogen III oxidase is involved in the anaerobic transformation
of coproporphyrinogen-III into protoporphyrinogen-IX. It requires Mg+, ATP
and NAD for activity.

Blast Summary:  PSI-Blast Search
Gapped BLAST and PSI-BLAST reveal strong hits to several oxygen-independent
coproporphyrinogen oxidases. For example residues 4-391 are 18% similar
to HEMN_ECOLI, oxygen-independent coproporphyrinogen III oxidase of
Escherichia coli, (D16509).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0635
COG name: Coproporphyrinogen III oxidase and related FeS oxidoreductases
Functional Class:? H
The phylogenetic pattern of COG0635 is -----QvCEBrhUJ--olINx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 8-83 are 43% similar to YGGW_HAEIN, a hypothetical protein
with similarity to COPROPORPHYRINOGEN III OXIDASES. Residues 96-210
and 204-257 also support a match to COPROPORPHYRINOGEN III OXIDASES.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 10 to 191 (E-value = 5.9e-20) place TP0186 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 254 to 377 (E-value = 2.4e-21) place TP0186 in the HemN_C family which is described as HemN C-terminal region (PF06969)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
121  
155

PDB Hit:
none

Gene Protein Sequence:
MSSEVGASLYVHIPFCAQRCAYCDFYSLVRSTYFRPHQPCPHFIDRLLQD
VALQRECFGVQGWQTVYMGGGTPSLLAPQDIRHFCVALRAAQRYPIQEFT
LEVNPEDVTEEFLCACAEGGVNRLSLGVQSLRDEVLRAERRAASAECART
ALRVMTANARFFSGGVRISADLIAGLRGQTARMVREDIDELLSFGLRHVS
LYGLCVPHPTETQEERIAALWAHGSAYLVRAGFNRYELSNFARTAADESA
HNRAYWRMAPHAGVGPGAVGTRFVNLSLSKEGAWAIRSTVRKHLGQYLAE
VCRENVYEHEFLTEHMCVQEALLMGLRLEQGLDVVTFRARFGKGIEAYIG
KTIARWQCHGRMQRTATSLRLSAQARVFLDSFLREAFAELART

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCTGAGGTCGGTGCGTCTTTGTACGTGCACATCCCCTTCTGTGC
GCAACGCTGTGCTTACTGCGATTTTTACTCCCTGGTGCGTTCAACCTATT
TTAGGCCTCATCAGCCTTGTCCGCATTTTATCGATCGGCTGCTACAGGAT
GTGGCATTGCAGCGGGAGTGCTTTGGGGTCCAGGGGTGGCAGACAGTGTA
TATGGGTGGAGGTACCCCTTCGCTATTGGCACCGCAGGACATTCGTCATT
TTTGCGTAGCGTTACGCGCCGCGCAGCGGTATCCGATTCAGGAGTTCACT
CTTGAGGTGAATCCTGAGGATGTGACCGAAGAGTTTTTGTGTGCGTGTGC
AGAAGGCGGAGTAAACCGTTTATCCCTTGGGGTACAAAGTCTGCGTGATG
AGGTGTTGCGTGCGGAGCGTCGTGCAGCCTCTGCTGAATGTGCTCGTACC
GCGCTCCGCGTGATGACGGCAAATGCGCGCTTTTTCTCTGGCGGGGTGCG
TATTTCAGCAGATCTCATCGCTGGATTGCGCGGGCAAACGGCGCGAATGG
TGCGTGAGGATATAGATGAGCTTTTGTCTTTTGGGCTGAGACACGTGTCG
CTATATGGGTTGTGTGTACCGCATCCGACTGAAACGCAAGAGGAGCGAAT
TGCAGCGCTTTGGGCACACGGCAGCGCGTATCTGGTGCGTGCAGGATTTA
ACCGGTATGAGCTTTCGAATTTTGCACGTACTGCGGCGGACGAGAGCGCG
CACAACAGAGCATATTGGCGGATGGCACCGCACGCAGGGGTGGGGCCTGG
CGCAGTTGGCACGCGTTTTGTCAACCTTTCTTTATCAAAGGAGGGGGCGT
GGGCGATCCGCAGCACGGTGCGGAAACATCTTGGCCAATACTTAGCAGAA
GTGTGTCGGGAAAATGTGTATGAGCACGAATTCCTTACAGAACATATGTG
TGTGCAAGAAGCATTGTTAATGGGATTACGTCTTGAACAGGGACTGGATG
TGGTTACATTTCGTGCGCGGTTCGGGAAGGGAATTGAAGCGTACATTGGC
AAAACAATCGCGCGGTGGCAGTGTCATGGCCGAATGCAGCGGACGGCGAC
GTCATTGCGTTTGAGTGCGCAGGCACGGGTATTTCTGGACAGTTTTTTGC
GAGAGGCGTTTGCAGAACTTGCGCGCACG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy