Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR135 IGR137 IGR136 IGR143 IGR142 IGR139 IGR140 IGR141 IGR138 smpB, - TP0184 TP0183 TP0178 TP0179 rpsJ, - TP0188 rplC, - TP0189 rplD, - TP0190 sip, - TP0185 TP0182 hemN, - TP0186 tuf, - TP0187 smpB, - TP0184 TP0183 TP0178 TP0179 rpsJ, - TP0188 rplC, - TP0189 rplD, - TP0190 sip, - TP0185 TP0182 hemN, - TP0186 tuf, - TP0187 Type: tandem, Name:  - 56 smpB, - TP0184 TP0183 TP0178 TP0179 TP0180 TP0180 rpsJ, - TP0188 rplC, - TP0189 rplD, - TP0190 sip, - TP0185 hemN, - TP0186 tuf, - TP0187 rplW, - TP0191 TP0181 TP0182 rplW, - TP0191 TP0181
* Calculated from Protein Sequence

Gene ID: TP0185

DNA Molecule Name:
1  

Genbank ID:
3322449

Gene Name:
sip  

Definition:
signal peptidase I

Gene Start:
201075

Gene Stop:
201779

Gene Length:
705

Molecular Weight*:
26866

pI*:
10.35

Net Charge*:
9.06

EC:
3.4.21.89  

Functional Class:
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Sharkov NA, Cai D.
Discovery of substrate for type I signal peptidase SpsB from Staphylococcus aureus.
J Biol Chem. 2002 Feb;277(8):5796-803.
PMID: 11741926

Cregg KM, Wilding I, Black MT.
Molecular cloning and expression of the spsB gene encoding an essential type I signal peptidase from Staphylococcus aureus.
J Bacteriol. 1996 Oct;178(19):5712-8.
PMID: 8824617

Pollock TJ, Thorne L, Yamazaki M, Mikolajczak MJ, Armentrout RW.
Mechanism of bacitracin resistance in gram-negative bacteria that synthesize exopolysaccharides.
J Bacteriol. 1994 Oct;176(20):6229-37.
PMID: 7928993

Comment:
Signal peptidase I cleaves N-terminal leader sequences from secreted
protein precursors.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to type-I signal
peptidase proteins. For example residues 23-232 are 24% similar to
type-I signal peptidase SpsB of Staphylococcus aureus, (U65000).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0681
COG name: Signal peptidase I
Functional Class:? N
The phylogenetic pattern of COG0681 is AmTKYqvCeBrhuj--OLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 28-53, 71-86, 122-133, 188-207, and 146-165 represent
significant hits to blocks (BL00501A,B,C,D), Signal peptidases I
serine proteins.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0926 also a signal
peptidase I. Residues 33-151 are 29% similar and 147-207 are 32%
similar to TP0926.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
25  
45

PDB Hit:
none

Gene Protein Sequence:
MFARWRRYSYLARREARRNATAVCSAGVGFFLFYLFITTHVVAAYRIQAD
SMQPTLSAGDCVLASSLFRFARIKRGDLVLATPLEKEDIGLFKRAMNAVL
GFASLQLYRPFGAADRMFSRPQMRRVVGLPGDTVYMRDFVLYVKPHGQQH
FLTEFEVSAVSYDVRKGVLPEHWSERLPFSGFMEEMQLDEHSYFVLCDNR
IVSSDSRLWGAIDGSTQIKAKAFMRYFPFGAFGVL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGCGCGGTGGAGAAGGTACTCATATTTGGCGCGGCGCGAAGCACG
GCGGAATGCGACCGCAGTTTGTAGTGCTGGGGTGGGCTTCTTTCTGTTCT
ATCTTTTTATCACTACGCATGTGGTTGCAGCGTATCGCATTCAGGCGGAC
TCGATGCAGCCGACCCTGAGCGCAGGGGATTGCGTTCTTGCCTCGTCCCT
GTTTCGCTTTGCCCGCATCAAGCGGGGGGATTTGGTGCTTGCAACTCCCC
TTGAGAAAGAGGATATAGGCCTGTTTAAAAGGGCGATGAATGCTGTGTTA
GGCTTCGCAAGCCTTCAATTGTACCGGCCGTTTGGCGCGGCAGATCGCAT
GTTTTCGCGGCCGCAAATGCGCAGGGTGGTGGGCCTTCCAGGGGACACTG
TCTATATGCGCGATTTTGTGCTGTACGTTAAGCCCCACGGTCAGCAACAC
TTCCTCACGGAATTTGAAGTGAGTGCAGTTAGCTACGACGTGCGTAAGGG
GGTGCTTCCTGAGCATTGGTCTGAACGGCTTCCCTTTTCTGGTTTCATGG
AAGAGATGCAGTTGGACGAGCACTCCTACTTCGTGCTGTGCGATAATCGA
ATTGTCTCCAGTGATTCTCGTCTGTGGGGTGCCATCGACGGTAGTACGCA
GATAAAAGCAAAGGCATTCATGCGTTATTTCCCTTTCGGAGCATTTGGTG
TCTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy