Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Met-1 IGR126 IGR127 IGR133 IGR132 IGR128 IGR130 IGR125 IGR131 IGR129 TP0176 TP0172 TP0174 TP0177 TP0169 tpp15, - TP0171 troR, - TP0167 pgm, - TP0168 deoD,pfs, - TP0170 troC, - TP0165 troA,tromp1, - TP0163 troD, - TP0166 TP0176 TP0172 TP0174 TP0177 TP0169 tpp15, - TP0171 troR, - TP0167 pgm, - TP0168 deoD,pfs, - TP0170 troC, - TP0165 troA,tromp1, - TP0163 troD, - TP0166 Type: tandem, Name:  - 55 TP0172 TP0177 TP0175 TP0173 TP0173 TP0176 TP0174 TP0175 tpp15, - TP0171 troR, - TP0167 pgm, - TP0168 deoD,pfs, - TP0170 troC, - TP0165 troD, - TP0166 troB, - TP0164 troA,tromp1, - TP0163 TP0169 troB, - TP0164
* Calculated from Protein Sequence

Gene ID: TP0170

DNA Molecule Name:
1  

Genbank ID:
3322437

Gene Name:
deoD  pfs  

Definition:
pfs protein (purine nucleoside phosphorylase)

Gene Start:
190085

Gene Stop:
190891

Gene Length:
807

Molecular Weight*:
28652

pI*:
5.49

Net Charge*:
-3.60

EC:
2.4.2.1  2.7.-.-  

Functional Class:
Uncategorized  

Pathway: pathway table
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Primary Evidence:
Mushegian AR, Koonin EV. 1994. Unexpected sequence similarity between nucleosidases and phosphoribosyltransferases of different specificity. Protein Sci Jul;3(7):1081-8 Medline: 95004041.

Comment:
Reference:
Gene 197, 47-64 (1997).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed this protein is almost identical to Pfs protein
of Treponema pallidum,(U55214). Additionaly there were many significant
hits to other pfs proteins. For example residues 1-253 are 31% similar
to PFS_ECOLI.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0775
COG name: Nucleoside phosphorylase
Functional Class:  F
The phylogenetic pattern of COG0775 is ------vcEbRhuj--OliN-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 66-79, 164-174, 23-33, and 188-216 represent significant (98%)
hits to blocks BL01232C,D,E, Purine and other phosphorylases family 1
proteins. Residues 243-261, 180-201, and 88-111 represent significant
(95%) hits to blocks PR00632A,D,H, SONIC HEDGEHOG PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 39-91 are 43% similar to Y05A_MYCTU, a hypothetical protein
with similarity to Pfs proteins. Residues 191-252 are 38% similar to
PFS_HAEIN.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 242 (E-value = 1.5e-115) place TP0170 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
31  
50
transmembrane  
53  
77
transmembrane  
199  
216
non-globular  
234  
269

PDB Hit:
none

Gene Protein Sequence:
MTVGVFAALGEEVARVRECLGGVGTERAGLTFYVVSVGALQVVYVCGGVG
KVNAALCTQLLISEFGARVLINTGIAGALDERLCVFDVLVSVDAVQHDVD
VTAFGYQKGRIPRMDSVEWTANTALRYLVREAFDLCTRDPEWTEGACALS
GSGDPPSRVSRLVEGRVASGDLFVSDAQTRARIIREFGAHGVEMEGAAFA
HVASVNGVPFVIIRCISDGAGAEQDVSMSYKEFSTRAARRSALLTLRVLE
RLSALRTSVVASLFPMVVV

Gene Nucleotide Sequence:  Sequence Viewer
GTGACGGTCGGCGTTTTTGCTGCACTGGGAGAGGAGGTTGCGCGCGTACG
TGAGTGTCTCGGGGGAGTAGGTACAGAGCGGGCAGGGCTCACGTTCTATG
TTGTGTCGGTGGGTGCGCTTCAGGTGGTGTATGTGTGCGGCGGTGTTGGG
AAAGTGAATGCAGCGCTTTGCACTCAACTACTCATTTCGGAGTTTGGTGC
GCGTGTGCTTATCAATACAGGAATTGCAGGTGCTCTCGATGAGCGCTTGT
GTGTTTTTGATGTGCTAGTTTCTGTCGATGCAGTGCAGCATGATGTAGAC
GTTACCGCTTTTGGTTACCAGAAAGGGCGTATTCCGCGCATGGATTCTGT
AGAGTGGACTGCGAACACGGCATTGCGGTATTTGGTGCGGGAAGCCTTTG
ATCTCTGCACACGGGATCCGGAGTGGACCGAGGGTGCTTGTGCGCTCTCT
GGCTCGGGGGATCCGCCTTCTCGCGTTTCTCGTTTAGTCGAAGGGCGCGT
CGCCTCAGGGGATCTTTTCGTGTCAGATGCGCAAACACGTGCACGCATTA
TACGCGAATTTGGTGCGCATGGTGTGGAAATGGAGGGGGCAGCCTTTGCG
CATGTAGCGTCAGTTAATGGCGTCCCCTTTGTTATTATACGCTGTATATC
CGACGGTGCGGGTGCTGAGCAGGATGTCTCTATGAGTTATAAAGAGTTTT
CGACGCGTGCGGCGCGGCGTTCTGCCCTTTTGACGTTGCGTGTTCTTGAG
CGTCTCAGCGCTTTACGCACATCGGTAGTGGCTTCTCTTTTCCCGATGGT
CGTGGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy