Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Met-1 IGR126 IGR127 IGR133 IGR132 IGR128 IGR130 IGR125 IGR131 IGR124 IGR129 TP0176 TP0172 TP0174 ruvB, - TP0162 TP0177 TP0169 tpp15, - TP0171 troR, - TP0167 pgm, - TP0168 deoD,pfs, - TP0170 troC, - TP0165 troA,tromp1, - TP0163 troD, - TP0166 TP0176 TP0172 TP0174 ruvB, - TP0162 TP0177 TP0169 tpp15, - TP0171 troR, - TP0167 pgm, - TP0168 deoD,pfs, - TP0170 troC, - TP0165 troA,tromp1, - TP0163 troD, - TP0166 Type: tandem, Name:  - 55 TP0172 ruvB, - TP0162 TP0175 TP0173 TP0173 TP0174 TP0177 TP0176 TP0175 tpp15, - TP0171 troR, - TP0167 pgm, - TP0168 deoD,pfs, - TP0170 troC, - TP0165 troA,tromp1, - TP0163 troD, - TP0166 troB, - TP0164 troB, - TP0164 TP0169
* Calculated from Protein Sequence

Gene ID: TP0168

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgm  

Definition:
phosphoglycerate mutase (phosphoglyceromutase)

Gene Start:
189011

Gene Stop:
189763

Gene Length:
753

Molecular Weight*:
28344

pI*:
6.78

Net Charge*:
-0.73

EC:
5.4.2.1  5.4.2.4  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Glycolysis / Gluconeogenesis

Primary Evidence:
Hazlett KR, Rusnak F, Kehres DG, Bearden SW, LaVake CJ, LaVake ME, Maquire ME, Perry RD, Radolf JD.
The Treponema pallidum tro operon encodes a multiple metal transporter, a Zn-dependent transcriptional repressor, and a semi-autonomously expressed phosphoglycerate mutase.
J Biol Chem. 2003 Mar.
PMID: 12668673

Benoit S, Posey JE, Chenoweth MR, Gherardini FC.
Treponema pallidum 3-phosphoglycerate mutase is a heat-labile enzyme that may limit the maximum growth temperature for the spirochete.
J Bacteriol. 2001 Aug;183(16):4702-8.
PMID: 11466272


Comment:
Reaction:
2-PHOSPHOGLYCERATE + 2,3-DIPHOSPHOGLYCERATE =
3-PHOSPHOGLYCERATE + 2,3-DIPHOSPHOGLYCERATE


TP0168 was originally assigned three EC numbers, 5.4.2.1, 5.4.2.4, and 3.1.3.13 during our initial annotation of the Treponema genome. Comparison of our annotation with the annotation done by KEGGs leads us to re-examine this protein.

The top hits in gapped-blast were to phosphoglycerate mutase 1 (BPG-dependent PGAM 1) which is assigned the EC number 5.4.2.1 in the Swiss-Prot database. Several hits to mamalian phosphoglycerate mutases - brain form (BPG-dependent PGAM) were observed at lower significant levels. The EC numbers assigned to these proteins by Swiss-prot is 5.4.2.1, 5.4.2.4 and 3.1.3.13.

The clustalw phylogenetic tree indicates that TP0168 clusters with the phosphoglycerate mutase 1 proteins and not with the mamalian phosphoglycerate mutase brain form (BPG-dependent PGAM) proteins.
Significant similiarities exist with bisphosphoglycerate mutase (EC 5.4.2.4) indicating a paralogous relationship between these two types of enzymes.

Phosphoglycerate mutase (EC 5.4.2.1): This enzyme is also known as phosphoglycerate phosphomutase and phosphoglyceromutase. This enzyme is also capable of catalyzing the reactions of Bisphosphoglycerate mutase (EC 5.4.3.4) at a slower rate.

As a result of this re-examination, the EC number 3.1.3.13 for TP0168 has been removed.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed that this protein is identical to Pgm,
phosphoglycerate mutase of Treponema pallidum,(U55214). In addition there were many significant hits to other phosphoglycerate mutase
proteins.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0588
COG name: Phosphoglycerate mutase 1
Functional Class:  G
The phylogenetic pattern of COG0588 is ----Y---e-rh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 3-35, 53-64, 76-107 and 150-168 represent significant (100%)
hits to blocks (BL00175A,B,C,D), Phosphoglycerate mutase family
phosphohistidine proteins.

ProDom Summary:  Protein Domain Search
Residues 41-120 are 67% similar to phosphoglycerate mutase of PMG1_ECOLI.
Residues 3-39 and 168-223 are also strongly similar to phosphoglycerate
mutases. Residues 3-107 and 150-215 are weakly similar to 6-PHOSPHOFRUCTO-
2-KINASE/ FRUCTOSE-2,6-BISPHOSPHATASE proteins.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 229 (E-value = 5e-136) place TP0168 in the PGAM family which is described as Phosphoglycerate mutase family (PF00300)

PDB Hit:
gi|2624630|pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Transferase (Phosphoryl), Glycolytic Enzyme, Isomerase Mol_id: 1; Molecule: Phosphoglycerate Mutase 1; Chain: A, B, C, D; Ec: 5.4.2.1; Engineered: Yes; Biological_unit: Hom...

Gene Protein Sequence:
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFD
LCYTSFLKRAIRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTET
AQKYGEQQVRVWRRSFDVAPPPLTVGDARCPHTQASYRGVCASGRTPVLP
FTESLKDTVARVVPYFEEEIKPQMISGQRVLIVAHGNSLRALMKHIESLD
ETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAARAQAVADQGKS
N

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCTTGTGTTGATCCGTCATGGAGAAAGTGAATGGAACAGGCTGAA
CCTGTTCACTGGTTGGACAGATGTTCCGCTTACCCCACGTGGGGAGTCGG
AAGCCCAGGAAGGAGGCCGCGTACTGCAAGAAGCGGGGTTTGATTTTGAC
CTATGCTACACTTCTTTCTTGAAACGTGCCATTCGTACGCTCAATTTTGT
ACTCCAGGCACTGGACCGTGAGTGGTTGCCGGTTCACAAAAGCTGGAAAT
TGAACGAGCGGCATTATGGGGATCTACAAGGTTTAAATAAGACAGAGACG
GCGCAGAAGTATGGTGAGCAGCAGGTTAGGGTGTGGCGTCGCTCCTTTGA
TGTGGCTCCTCCTCCGCTTACTGTAGGGGACGCACGTTGTCCGCATACTC
AAGCCTCCTACCGGGGGGTATGCGCGTCTGGTCGGACGCCAGTACTTCCG
TTTACGGAAAGTTTGAAAGATACCGTTGCGCGTGTGGTGCCGTATTTTGA
AGAGGAAATCAAACCGCAGATGATTTCCGGACAGCGTGTGCTTATTGTGG
CGCATGGTAACTCGTTGCGCGCACTGATGAAGCACATAGAGTCTTTGGAT
GAGACTCAGATAATGGAAGTAAATTTGCCTACCGGTGTACCGCTTGTCTA
TGAGTTCGAGGCGGATTTTACCCTGTGTGGGAAGCGTTTTTTAGGTAATG
AGGCGGATGTTGCAGCGAGGGCGCAGGCTGTGGCTGATCAGGGTAAGAGT
AAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy