Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR122 IGR120 IGR123 IGR119 IGR121 IGR125 IGR124 TP0161 TP0156 TP0158 TP0157 TP0159 ruvB, - TP0162 proS, - TP0160 troC, - TP0165 troA,tromp1, - TP0163 TP0155 TP0161 TP0156 TP0158 TP0157 TP0159 ruvB, - TP0162 proS, - TP0160 troC, - TP0165 troA,tromp1, - TP0163 TP0155 Type: tandem, Name:  - 236 TP0161 TP0156 TP0158 TP0157 TP0159 ruvB, - TP0162 proS, - TP0160 troC, - TP0165 troA,tromp1, - TP0163 TP0155 troB, - TP0164 troB, - TP0164
* Calculated from Protein Sequence

Gene ID: TP0160

DNA Molecule Name:
1  

Genbank ID:
3322426

Gene Name:
proS  

Definition:
prolyl-tRNA synthetase

Gene Start:
183272

Gene Stop:
181422

Gene Length:
1851

Molecular Weight*:
68185

pI*:
6.74

Net Charge*:
-3.92

EC:
6.1.1.15  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Amino acid metabolism; Arginine and proline metabolism
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
This aminoacyl-tRNA synthetase charges tRNA (pro) with proline.



Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to prolyl-tRNA
synthetase proteins. For example residues 7-577 are 41% similar to
prolyl-tRNA synthetase of Bacillus subtilis, (accession# Z99112).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0442
COG name: Prolyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0442 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 269-520 are 35% similar to prolyl-tRNA synthetase of SYP_SYNY3.
Residues 31-97, 127-172, 191-225, 452-507 and 540-574 also support this
match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0837, threonyl-tRNA
synthetase. Residues 63-182 are 29% similar to TP0837.

Pfam Summary:  Pfam Search
Residues 36 to 190 (E-value = 1.9e-50) place TP0160 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 263 to 429 (E-value = 3.4e-09) place TP0160 in the YbaK family which is described as YbaK / prolyl-tRNA synthetases associated domain (PF04073)
Residues 517 to 607 (E-value = 2.3e-20) place TP0160 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
11
non-globular  
322  
395

PDB Hit:
none

Gene Protein Sequence:
MSAFFAPTLRSAPADATIASHQLLMRAGYVRKIANGLFAYLPLGLRVRHK
IEAIIREELEAIGCLECTAPVVTPAELWKESGRWYRMGAELLRAKNRLDH
ELLFSPTAEESFTALVRGDCTSYKHFPLSLYQINAKYRDEIRPRYGLMRA
REFTMADAYSFHTDCACLARTYEKFAHAYRAIFRRIGLSVIAVHAHLGAM
GGQESEEFMVESAVGDNTLLLCPHCTYAANCEKAVGQRPLPDTHDTHLKD
EHEGSDLKTPAAMREVHTPHVKTIEELEHFLHVPAHRCIKTLIYRIDTVP
QAAGHFVAVCIRGDLELNESKLEALLRVPSVVLATEQEVYALSGTPVGFI
GPVGLAQRAAAAYAARTPAFFPSAAEPASVTSDIPFFSLVADQSVMAMHN
AITGALKVDTHLVQVEPGRDFVPDAVADLMLVRAGDRCIHCGAPLYEKKG
NELGHLFKLGDKYTRSMHLTFTDEQGVRQFPLMGCYGIGLDRTLASVVEN
HHDTRGISWPLAISPYAVVLIPIPHTQAPYAAAEALYVQLRTRGVEVLFD
DRAERPGVKFADADLIGIPLRVVLSAKTLPRVECTTRCGAHTYFFTQEEA
SEHIARLLEQLASPESS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGCGTTTTTTGCACCAACCCTGCGGTCTGCACCTGCTGATGCAAC
CATCGCAAGCCACCAGCTGCTCATGCGCGCAGGGTACGTCAGAAAAATCG
CCAACGGCCTGTTTGCGTACCTTCCCCTGGGCCTGCGCGTTCGACACAAA
ATTGAAGCGATTATTCGGGAAGAACTCGAGGCTATCGGGTGTTTGGAGTG
CACCGCGCCTGTCGTGACTCCTGCAGAGTTGTGGAAGGAATCTGGCCGCT
GGTACCGCATGGGCGCAGAGCTTTTGCGCGCCAAAAATCGGCTCGATCAC
GAGCTCCTTTTCAGTCCGACTGCAGAAGAATCCTTCACCGCTTTGGTGCG
CGGCGACTGTACTTCCTACAAACATTTTCCCCTCAGTCTCTACCAAATCA
ACGCAAAATATCGCGATGAAATCCGTCCGCGTTACGGACTGATGCGCGCG
CGCGAGTTCACCATGGCCGACGCCTATTCTTTCCACACAGACTGCGCATG
CCTTGCGCGCACGTACGAAAAGTTTGCGCACGCGTATCGCGCCATTTTCC
GTCGCATCGGCCTATCAGTCATTGCAGTACATGCACACCTCGGTGCGATG
GGGGGGCAGGAATCCGAGGAATTCATGGTAGAGTCCGCGGTGGGCGACAA
CACGCTCCTGTTGTGTCCCCACTGCACCTACGCTGCAAATTGCGAAAAGG
CCGTCGGACAGCGCCCCCTCCCAGACACGCATGACACTCATCTAAAAGAC
GAACACGAAGGGTCAGATCTCAAGACGCCTGCAGCAATGCGCGAGGTGCA
CACCCCGCACGTGAAAACTATTGAGGAACTTGAACACTTCTTGCACGTAC
CTGCACATCGCTGCATCAAGACGCTTATTTACCGCATTGACACGGTGCCC
CAGGCGGCTGGGCATTTTGTGGCAGTGTGCATCCGCGGCGACCTAGAACT
CAACGAGTCAAAGCTCGAAGCGCTCCTGCGCGTGCCATCTGTAGTACTGG
CAACTGAACAAGAGGTGTATGCACTCAGCGGCACCCCCGTAGGATTCATT
GGTCCGGTAGGACTTGCACAGCGTGCTGCAGCTGCGTATGCCGCTCGCAC
CCCTGCGTTCTTCCCCTCCGCTGCTGAGCCTGCATCCGTCACTTCTGACA
TTCCATTTTTTTCCCTCGTTGCAGATCAGTCCGTGATGGCTATGCACAAC
GCTATCACCGGTGCGTTGAAAGTTGACACGCATCTTGTGCAGGTAGAACC
GGGTCGAGACTTTGTTCCTGACGCAGTTGCAGATCTCATGCTCGTGCGCG
CCGGCGACCGGTGCATACACTGTGGAGCGCCCCTATACGAAAAAAAGGGT
AACGAACTAGGTCACCTCTTTAAATTAGGGGACAAATACACGCGCAGCAT
GCACCTTACCTTTACTGATGAGCAGGGTGTACGACAGTTCCCCCTGATGG
GCTGCTATGGCATTGGCCTTGATCGCACGCTTGCCTCTGTGGTGGAAAAC
CACCATGACACGCGGGGTATCAGCTGGCCGCTTGCGATCAGCCCCTATGC
AGTTGTGCTCATACCCATCCCTCACACGCAGGCCCCCTATGCAGCAGCAG
AGGCACTGTACGTGCAGCTGCGGACACGGGGAGTTGAGGTACTGTTTGAT
GATCGTGCAGAGCGACCCGGAGTAAAGTTCGCAGACGCTGATTTAATCGG
TATTCCCCTTCGTGTGGTACTGAGTGCGAAAACGCTACCGCGCGTTGAAT
GCACAACACGGTGTGGTGCGCACACGTATTTTTTTACGCAAGAAGAGGCG
TCCGAGCACATTGCACGCCTGCTCGAACAACTCGCTTCCCCGGAAAGTTC
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy