Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR122 IGR120 IGR118 IGR123 IGR119 IGR116 IGR121 IGR117 TP0161 TP0156 TP0153 TP0158 TP0157 TP0159 ruvB, - TP0162 rnfC, - TP0152 proS, - TP0160 TP0154 TP0155 TP0161 TP0156 TP0153 TP0158 TP0157 TP0159 ruvB, - TP0162 rnfC, - TP0152 proS, - TP0160 TP0154 TP0155 Type: tandem, Name:  - 235 Type: tandem, Name:  - 53 Type: tandem, Name:  - 286 Type: tandem, Name:  - 54 Type: tandem, Name:  - 234 Type: tandem, Name:  - 236 TP0161 TP0156 TP0153 TP0158 TP0157 TP0159 ruvB, - TP0162 rnfC, - TP0152 proS, - TP0160 TP0154 TP0155
* Calculated from Protein Sequence

Gene ID: TP0157

DNA Molecule Name:
1  

Genbank ID:
3322424

Gene Name:


Definition:
conserved hypothetical protein/ possible glycerol-3-phosphate acyltransferase

Gene Start:
179588

Gene Stop:
178689

Gene Length:
900

Molecular Weight*:
34455

pI*:
7.39

Net Charge*:
1.97

EC:
2.3.1.15  

Functional Class:
Conserved hypothetical  

Pathway: pathway table
Miscellaneous Enzymes

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST returned only one hit to putative glycerol-3-phosphate
O-acyltransferase of Borrelia burgdorferi,(accession# AE001139).
Residues 5-261 are 33% similar to the Borrelia protein. Subthreshold
hits to plant glycerol-3-phosphate acyltransferase sequences.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MSIHSLQQTFSDIVPLLEQYTRADRFMREDNLLHERNEPIRRIVESLVAR
ILLPGSTMRGNEQIASFLHKTNEGKRGLILAEHYSNFDLPCLLYLMEQGS
SAGRMLSEKIVSIAGIKLREENRILAMLTEGYDHLVIYPSRSLATITDAH
CLARETKRSRALNRAAMKYLEELRNAGKVILVFPAGTRYRPGRPETKRGV
REVYSYIKHAEVLLLISINGNCLRVAERSTDMTEDAVHPDVVLLEARTVD
DCALFREKALDWHRTHNVAAPSEDKKQIVVDYVMHLLEEMHEHNERERLS


Gene Nucleotide Sequence:  Sequence Viewer
GTGAGTATACATTCGTTGCAGCAGACTTTTAGCGACATCGTCCCGCTCCT
GGAGCAGTATACGCGCGCAGACCGCTTCATGCGGGAGGATAATTTGTTAC
ACGAGAGAAACGAACCTATCCGGCGTATCGTTGAGTCCCTCGTCGCCCGC
ATATTACTCCCCGGCTCCACAATGCGCGGAAATGAGCAAATCGCATCCTT
TTTACATAAAACCAATGAAGGGAAACGGGGACTCATTCTTGCGGAACACT
ACAGCAATTTTGACTTACCCTGTCTGCTCTACCTTATGGAACAAGGAAGT
AGTGCCGGGCGCATGCTTTCAGAAAAAATCGTATCTATTGCCGGTATTAA
ACTTCGTGAAGAAAATCGCATCCTGGCAATGCTCACCGAAGGATATGATC
ACCTGGTGATATATCCCAGTAGGAGTTTGGCCACCATCACTGATGCGCAC
TGTCTTGCAAGAGAGACAAAGCGCAGCCGAGCACTGAATCGTGCAGCTAT
GAAGTATTTAGAGGAACTGCGCAACGCGGGAAAGGTGATTCTCGTGTTTC
CTGCAGGGACACGCTACCGACCCGGGAGACCGGAAACAAAGCGAGGGGTG
CGCGAAGTATACTCCTACATAAAACACGCCGAGGTACTGCTCCTTATTTC
AATCAATGGGAATTGTTTGCGCGTTGCAGAACGTTCAACTGATATGACGG
AAGACGCGGTGCATCCGGATGTCGTGCTTCTTGAAGCGCGCACTGTAGAC
GACTGCGCCCTTTTTCGAGAAAAAGCGCTGGACTGGCACCGCACACACAA
CGTGGCGGCACCGTCAGAGGATAAAAAACAAATCGTAGTCGACTATGTCA
TGCACCTTTTGGAAGAAATGCACGAGCACAATGAACGAGAAAGGCTATCG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy