Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-1 IGR115 IGR114 IGR113 TP0149 tbpA, - TP0144 rnfC, - TP0152 amy1, - TP0147 chrA, - TP0146 TP0145 TP0149 tbpA, - TP0144 rnfC, - TP0152 amy1, - TP0147 chrA, - TP0146 TP0145 Type: tandem, Name:  - 52 Type: tandem, Name:  - 49 Type: tandem, Name:  - 50 Type: tandem, Name:  - 51 Type: tandem, Name:  - 234 tbpA, - TP0144 rnfC, - TP0152 amy1, - TP0147 TP0148 TP0151 TP0151 TP0149 TP0150 TP0150 TP0148 chrA, - TP0146 TP0145
* Calculated from Protein Sequence

Gene ID: TP0147

DNA Molecule Name:
1  

Genbank ID:
3322410

Gene Name:
amy1  

Definition:
alpha-amylase 1

Gene Start:
171138

Gene Stop:
169282

Gene Length:
1857

Molecular Weight*:
70397

pI*:
7.10

Net Charge*:
0.85

EC:
3.2.1.1  

Functional Class:
Central intermediary metabolism; Polysaccharides  

Pathway: pathway table
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Morlon-Guyot J, Mucciolo-Roux F, Rodriguez Sanoja R, Guyot JP.
Characterization of the L. manihotivorans alpha-amylase gene.
DNA Seq. 2001 Jul;12(1):27-37.
PMID: 11697143

Bibel M, Brettl C, Gosslar U, Kriegshäuser G, Liebl W.
Isolation and analysis of genes for amylolytic enzymes of the hyperthermophilic bacterium Thermotoga maritima.
FEMS Microbiol Lett. 1998 Jan;158(1):9-15.
PMID: 9453151

Lin LL, Hsu WH, Chu WS.
A gene encoding for an alpha-amylase from thermophilic Bacillus sp. strain TS-23 and its expression in Escherichia coli.
J Appl Microbiol. 1997 Mar;82(3):325-34.
PMID: 12455896

Comment:
This enzyme acts on starch, glycogen and related polysaccharides and
oligosacchrides in a random; reducing groups are liberated in the
alpha- configuration.

Reaction:
ENDOHYDROLYSIS OF 1,4-ALPHA-GLUCOSIDIC
LINKAGES IN OLIGOSACCHARIDES AND POLYSACCHARIDES.

Blast Summary:  PSI-Blast Search
After gapped-BLAST the strongest hit was to AMY1_DICTH alpha amylase 1 of
Dictyoglomus thermophilum, (accession# X07896). Residues 34-513 are
19% similar to AMY1_DICTH.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 34-149 are 27% similar to ALPHA-AMYLASE 1 of AMY1_DICTH.
Residue 293-400 are 25% similar to AMY1_DICTH.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 12 to 351 (E-value = 5.2e-100) place TP0147 in the Glyco_hydro_57 family which is described as Glycosyl hydrolase family 57 (PF03065)

PDB Hit:
none

Gene Protein Sequence:
MKKGDNTKIRIAFAAKLTEACVQSLHAEHDPSQYQAFFSGLCRHEQLPLT
VHMTGSFFQFIQKKNSPYPYLINNLLGSKRLELLSGGFYQPYLPLLPQAD
VISQIELLTSTLREHVIKRPRGCFLEASAWSAALIPSLVKAGMEYCLLDY
RLFEASDMPATKPAVLEDSSKCLVALPYRELTIDTPAETFYAQLVARYGD
TPGTVLIFMLPLDCYQKLFFTHDNASTWFKTFIQYVQKPNSPFRLTHTGE
IYKEPPVCFGYIASNMVRNDVLLHKTAKQLIICSTHARLLYAKMMYVHNI
AMQIKGDKQRKHHALSELWKAEQGVFFISSDRGYASAGSAQRTAYKYLLT
AEKVARTPGVFNNSLITFDFNFDGVREFLSQRELMNMYVQLPGGLIFEFD
IFSSYKNYAAVPRQPGGIFIDYVLSEQDVVHLRENPGHAVPTVFSHTPYQ
EIGFDPIKHELTLRAEGIFEEFNQPVSLKKQYFFKSEGVQVQYILKNESP
LNLSAFFAVEMNLAVHGTDDAAPELVVFSENEKYTAAITRDHFPCISWMR
LTDPEGKTVFTIEGNENPDVAITPLCESTSNQYANTEGIKCLFYWKVDLN
AGYETEKMLFLKAFSTKKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAGGAGACAATACCAAAATACGTATCGCATTTGCTGCGAAGTT
AACGGAAGCATGTGTTCAGTCCCTGCACGCAGAGCACGATCCTTCTCAGT
ACCAGGCATTTTTTTCAGGTCTGTGCAGGCACGAACAACTCCCACTGACG
GTGCACATGACCGGTTCTTTTTTTCAATTTATACAAAAAAAGAATTCTCC
CTATCCTTATCTTATCAACAATCTGCTTGGTTCCAAACGGCTTGAATTAC
TCAGCGGCGGTTTTTACCAGCCGTATCTTCCCCTCCTCCCTCAGGCGGAT
GTAATTAGTCAAATTGAGCTACTCACTTCTACCTTGCGAGAACACGTTAT
AAAACGCCCACGGGGCTGCTTTCTGGAAGCATCTGCATGGAGCGCCGCGC
TCATTCCCTCACTCGTAAAGGCCGGAATGGAATACTGTCTCCTAGATTAC
CGTCTCTTCGAAGCCTCTGATATGCCCGCTACTAAACCTGCAGTACTTGA
GGACAGCAGCAAATGCCTTGTTGCATTACCGTACCGCGAACTGACGATTG
ACACCCCCGCTGAAACATTCTATGCGCAACTTGTCGCACGGTACGGCGAC
ACCCCCGGTACTGTGCTCATTTTCATGCTTCCGCTCGACTGCTACCAAAA
ATTATTTTTTACACACGACAATGCATCCACTTGGTTTAAAACATTTATTC
AATACGTGCAAAAACCGAACTCTCCCTTTCGTTTAACGCATACTGGAGAA
ATATACAAAGAGCCTCCTGTTTGTTTCGGATACATCGCTTCGAATATGGT
GCGAAACGATGTCCTTTTGCACAAAACGGCCAAGCAATTAATAATATGCA
GCACACACGCGCGGTTGTTGTACGCAAAGATGATGTACGTACACAATATT
GCTATGCAAATTAAAGGAGATAAACAACGCAAGCATCATGCACTGTCCGA
ATTATGGAAAGCAGAACAGGGAGTTTTTTTTATTTCTTCTGATCGGGGGT
ACGCATCCGCAGGAAGCGCGCAACGTACTGCATATAAATACCTCCTGACT
GCAGAAAAAGTGGCACGCACTCCTGGTGTGTTTAATAATTCTCTCATTAC
GTTCGACTTTAACTTCGATGGTGTACGGGAGTTTCTCTCTCAAAGGGAGC
TGATGAATATGTACGTCCAATTACCAGGTGGACTGATTTTTGAATTTGAC
ATTTTTTCATCGTATAAAAACTATGCAGCAGTCCCTCGACAACCGGGAGG
CATTTTTATTGACTATGTGCTCTCTGAGCAAGATGTTGTGCACCTGCGAG
AAAACCCCGGCCATGCCGTGCCCACGGTGTTCTCGCATACCCCTTATCAG
GAAATAGGATTCGATCCTATAAAGCACGAGCTTACACTTAGGGCGGAAGG
TATCTTTGAAGAATTCAATCAGCCTGTTTCATTAAAAAAACAGTACTTTT
TTAAGTCTGAAGGCGTACAAGTTCAGTACATCTTAAAAAACGAAAGTCCC
CTCAATCTTTCCGCATTTTTTGCAGTGGAAATGAATCTTGCCGTACACGG
TACTGATGACGCTGCACCCGAGCTTGTGGTTTTTTCGGAAAATGAAAAGT
ACACTGCAGCAATTACCCGTGATCATTTTCCCTGCATTTCATGGATGCGT
CTTACCGATCCTGAGGGGAAGACTGTCTTTACGATCGAAGGAAACGAGAA
CCCTGACGTGGCTATCACGCCTCTGTGCGAAAGTACATCGAACCAGTATG
CAAACACCGAAGGCATCAAGTGTCTTTTCTACTGGAAAGTCGACTTGAAC
GCTGGATACGAAACAGAAAAGATGCTCTTTCTCAAAGCCTTTTCTACAAA
GAAAAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy