Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR110 IGR111 IGR113 IGR109 IGR112 TP0139 TP0138 ntpJ, - TP0140 TP0143 dat, - TP0141 TP0136 TP0145 TP0139 TP0138 ntpJ, - TP0140 TP0143 dat, - TP0141 TP0136 TP0145 Type: tandem, Name:  - 46 Type: tandem, Name:  - 285 Type: tandem, Name:  - 45 Type: tandem, Name:  - 49 Type: tandem, Name:  - 233 Type: tandem, Name:  - 48 Type: tandem, Name:  - 309 Type: tandem, Name:  - 47 Type: tandem, Name:  - 43 Type: tandem, Name:  - 44 TP0139 TP0138 ntpJ, - TP0140 TP0143 TP0142 tbpA, - TP0144 TP0142 tbpA, - TP0144 dat, - TP0141 TP0136 TP0145 TP0137 TP0137
* Calculated from Protein Sequence

Gene ID: TP0141

DNA Molecule Name:
1  

Genbank ID:
3322405

Gene Name:
dat  

Definition:
methylated-DNA-protein-cysteine S-methyltransferase

Gene Start:
161909

Gene Stop:
162439

Gene Length:
531

Molecular Weight*:
19363

pI*:
9.17

Net Charge*:
9.53

EC:
2.1.1.63  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is involved in the repair of alkylated guanine in DNA by
stoichiometrically transfering the alkyl group at the O-6 position to a
cysteine residue in the enzyme. This is a suicide reaction: the enzyme
is irreversibly inactivated.

Reaction:
DNA (CONTAINING O6-METHYLGUANINE) + PROTEIN L-CYSTEINE =
DNA (WITHOUT O6-METHYLGUANINE) + PROTEIN S-METHYL-L-CYSTEINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several hits to methylated-DNA-protein-cysteine
S-methyltransferase in the database. For example residues 14-170 are
37% similar to DAT1_BACSU, methylated-DNA-protein-cysteine
S-methyltransferase of Bacillus subtilis,(Z99111).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0350
COG name: Methylated DNA-protein cysteine methyltransferase
Functional Class:  L
The phylogenetic pattern of COG0350 is amtkyqv-EBRhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 90-131, 60-101, 140-170, and 141-171 represent significant
(100%) hits to blocks (BL00374A,B), Methylated-DNA--protein-cysteine
methyltransferase active sites.

ProDom Summary:  Protein Domain Search
Residues 97-170 are 47% similar to METHYLATED-DNA--PROTEIN-CYSTEINE
METHYLTRANSFERASE of ADAB_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 90 to 175 (E-value = 3.1e-32) place TP0141 in the Methyltransf_1 family which is described as 6-O-methylguanine DNA methyltransferase, DNA binding domain (PF01035)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
138  
159

PDB Hit:
gi|1942751|pdb|1SFE| Ada O6-Methylguanine-Dna Methyltransferase From Escherichia Coli Enzyme, Transferase, Methyltransferase, Nucleic Acid Binding Protein, Dna Repair Protein, Dna-Binding Protein Mol_id: 1; Molecule: Ada O6-Methylguanine-Dna Methyltra...

Gene Protein Sequence:
MSVHQGGIRFPLLYLEMETPLGRMCIAERAHTIVYVWFHRVGPRGSPVSG
VCAQHVCPGKTALLRETQSQIHAYFCGALREFSVPVTVEGTPFMQRVWGA
TRNIAYGTTKSYAQLSQDIGCPRAARAVGQALHRNPLLLLIPCHRVISAR
ASIGGFAYGSALKHFLLQQEAAVCACE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTGCATCAGGGTGGGATACGTTTTCCCTTGCTGTATCTAGAGAT
GGAAACACCGCTCGGTCGTATGTGCATAGCCGAGCGAGCGCACACTATTG
TGTATGTGTGGTTCCATCGGGTTGGTCCAAGAGGATCTCCTGTATCTGGT
GTGTGCGCGCAGCACGTGTGCCCGGGTAAAACGGCGCTCTTGCGTGAGAC
GCAGTCCCAAATTCACGCTTACTTTTGTGGAGCGCTGCGCGAGTTTTCAG
TACCGGTCACGGTAGAGGGCACGCCTTTTATGCAACGCGTCTGGGGCGCC
ACGCGCAACATCGCGTACGGCACGACAAAAAGCTATGCACAGCTTTCACA
GGACATCGGCTGTCCACGCGCCGCACGCGCAGTTGGGCAGGCATTGCATC
GCAACCCGCTGCTTTTGCTTATTCCTTGCCATCGGGTAATAAGTGCGCGT
GCATCAATCGGCGGTTTTGCGTACGGGAGTGCTCTCAAGCATTTTTTGCT
GCAGCAAGAGGCGGCTGTGTGCGCATGTGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy