Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 IGR110 IGR111 IGR113 IGR109 IGR112 IGR108 TP0139 TP0138 TP0135 ntpJ, - TP0140 TP0143 dat, - TP0141 TP0136 TP0139 TP0138 TP0135 ntpJ, - TP0140 TP0143 dat, - TP0141 TP0136 Type: tandem, Name:  - 46 Type: tandem, Name:  - 285 Type: tandem, Name:  - 45 Type: tandem, Name:  - 232 Type: tandem, Name:  - 309 Type: tandem, Name:  - 233 Type: tandem, Name:  - 48 Type: tandem, Name:  - 44 Type: tandem, Name:  - 308 Type: tandem, Name:  - 47 Type: tandem, Name:  - 43 TP0139 TP0138 TP0135 ntpJ, - TP0140 TP0143 TP0142 tbpA, - TP0144 TP0142 tbpA, - TP0144 dat, - TP0141 TP0136 TP0137 TP0137
* Calculated from Protein Sequence

Gene ID: TP0140

DNA Molecule Name:
1  

Genbank ID:
3322404

Gene Name:
ntpJ  

Definition:
Probable sodium translocating ATPase subunit J

Gene Start:
161737

Gene Stop:
160013

Gene Length:
1725

Molecular Weight*:
62341

pI*:
9.34

Net Charge*:
12.69

EC:
3.6.1.34  

Functional Class:
Transport and binding proteins; Cations  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is likely involved in ATP-driven Na+ extrusion.

There is an N-terminal region of approximately 130 residues that
has no match to anything in the database.

Blast Summary:  PSI-Blast Search
There are many hits to Na+ -ATPase subunit J in the database. For
example residues 130-553 are 31% similar to NTPJ_ENTHR V-type Na+
-ATPase subunit of Enterococcus hirae, (accession# D17462).


COGS Summary:  COGS Search
BeTs to 13 clades of COG0168
COG name: Potassium uptake system component TrkG
Functional Class:  P
The phylogenetic pattern of COG0168 is amtkYqvcEB-h--gpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 481-511 represent a significant (98%) hit to blocks (BL00925A),
Pollen proteins Ole e I family proteins.

ProDom Summary:  Protein Domain Search
Residues 482-553 are 38% similar to V-TYPE SODIUM ATP SYNTHASE SUBUNIT
J of NTPJ_ENTHR. Residues 165-210, 285-327, and 399-447 agree with
this match as well. Residue 481-575 are similar to , a hypothetical
protein with similarity to V-TYPE SODIUM ATP SYNTHASE SUBUNIT J. Residues
107-336, 377-546, and 388-444 show weak similarity to POTASSIUM
TRANSPORT PROTEINS.


Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 234 to 561 (E-value = 1.5e-119) place TP0140 in the TrkH family which is described as Cation transport protein (PF02386)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
31  
51
non-globular  
60  
120
transmembrane  
133  
150
transmembrane  
167  
183
transmembrane  
195  
218
transmembrane  
250  
269
transmembrane  
311  
331
transmembrane  
353  
380
transmembrane  
417  
435
transmembrane  
485  
518
transmembrane  
523  
548

PDB Hit:
none

Gene Protein Sequence:
MRPMHIGNLTHLTMLVLCLAIRLCDQFLPFSVQFFTIVGDVGILVLVWSS
LASSLNKEKYVRTFLRQYTVPVFLGLLITLLTFVRASVTLTTASGDLYTT
LTHIQNITLGIFALIAFKAQKKFAERAVSNPSQTLIVSFLVVIFIGTHLL
MFPGATPHSQPLPMLTALFTATSAVCVTGLSVIDVATQLSTWGKAILAAL
IQIGGLGFMVFSFFGMITIKKKMSLESRLVASHLVSDSDMGSLSHNLKLI
IFSTFFIEALSALFLFVGFSQTEGYTIQSLGNAYFHAISAFCNAGFSLYP
NSLESFVSNPWITFPIAFTIILGGISFVVIDEVLCRVHGSIKNIFFKGKN
ILGSLSLNTFVVLKATVLLLAVSFVGIYLLEHTHSMKVYQVGTQYLAAFF
QAVTLRTAGFSTIPFSNLRTATLFFMTFIMFVGGASGSTAGGIKLNTAAA
IIASFRSFIHHDPKPRIRNLVIQGKQVERSFLILGFGICTVCLAGFCLSL
TDNIPFIYLLFESVSAFATVGLSVGITANLSTAGLMILLILMFTGRVGTL
TILTAASKEEQDMSVEYACGDLAIG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCCCCATGCATATTGGCAATCTCACTCATCTTACGATGCTCGTGTT
GTGCCTTGCGATTCGTTTGTGTGATCAATTCCTCCCGTTCTCGGTGCAGT
TTTTCACGATTGTAGGAGACGTGGGGATCTTGGTGCTTGTATGGTCTTCC
CTTGCTTCTTCCCTGAACAAAGAGAAGTATGTGCGCACCTTTCTGCGCCA
GTACACCGTACCAGTGTTCCTTGGATTGCTCATCACGCTCCTTACCTTCG
TGCGTGCAAGTGTGACGCTTACCACTGCCTCCGGTGATCTTTACACCACG
CTGACACATATACAGAATATTACGCTCGGTATCTTTGCACTCATCGCCTT
CAAAGCACAAAAGAAGTTTGCAGAGCGGGCAGTATCTAATCCATCACAGA
CGTTAATTGTTTCCTTTTTGGTGGTAATTTTCATAGGCACACATCTTCTG
ATGTTTCCCGGTGCCACGCCGCATAGTCAGCCCCTCCCCATGCTGACTGC
CTTGTTCACTGCAACATCCGCGGTATGCGTGACAGGGCTCTCGGTCATTG
ACGTTGCAACGCAGCTGAGTACGTGGGGAAAAGCCATCCTCGCTGCACTC
ATTCAGATTGGGGGACTAGGATTTATGGTGTTTTCGTTTTTTGGTATGAT
CACCATAAAGAAAAAGATGAGCCTCGAAAGCAGACTCGTCGCCTCGCATC
TGGTGAGCGACAGTGACATGGGCAGCCTATCCCATAACCTAAAGCTCATT
ATTTTCTCAACCTTTTTCATTGAAGCGCTCAGTGCGCTGTTTCTATTCGT
CGGTTTTAGCCAAACAGAAGGCTATACCATACAGTCTCTCGGCAATGCCT
ACTTCCATGCGATATCTGCGTTTTGCAATGCGGGGTTCTCCCTGTACCCA
AACAGTTTGGAATCGTTCGTTTCCAACCCATGGATAACGTTCCCCATTGC
CTTTACCATCATATTGGGGGGAATCAGTTTTGTGGTCATCGATGAAGTAC
TGTGCCGTGTCCACGGAAGTATCAAAAACATTTTTTTTAAGGGAAAAAAT
ATCCTCGGCTCTCTCAGCCTGAATACTTTTGTCGTGTTGAAAGCAACTGT
TCTGCTTCTTGCTGTTTCTTTTGTTGGTATCTATCTACTCGAACATACTC
ACTCCATGAAAGTCTATCAGGTAGGCACGCAGTACCTGGCCGCCTTTTTT
CAAGCGGTGACGCTGCGAACGGCAGGATTTTCTACTATCCCGTTTTCAAA
CCTCCGTACGGCGACGTTGTTTTTTATGACCTTTATTATGTTCGTAGGAG
GAGCGTCAGGGAGCACGGCAGGGGGGATCAAACTTAATACAGCGGCAGCG
ATTATCGCTTCTTTTCGCTCATTCATCCATCATGATCCAAAGCCACGCAT
TAGAAATTTAGTTATTCAGGGTAAGCAGGTTGAGCGGTCGTTTCTTATTC
TAGGGTTCGGTATTTGCACAGTGTGCCTTGCAGGTTTCTGCTTGAGTTTG
ACGGATAACATCCCGTTCATTTACCTTTTGTTCGAGTCGGTTTCTGCATT
CGCAACGGTTGGTCTTTCAGTTGGGATAACTGCCAATCTCAGTACTGCAG
GGCTGATGATCCTCTTAATTCTCATGTTTACCGGCAGGGTAGGAACCTTG
ACTATTTTAACTGCAGCAAGTAAAGAAGAACAGGATATGAGCGTCGAATA
CGCGTGTGGGGACTTAGCCATTGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy