Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR100 IGR107 IGR102 IGR106 IGR101 IGR103 IGR104 IGR105 TP0130 TP0126 TP0133 tprD, - TP0131 TP0129 TP0127 exoA, - TP0125 TP0124 TP0123 TP0130 TP0126 TP0133 tprD, - TP0131 TP0129 TP0127 exoA, - TP0125 TP0124 TP0123 Type: tandem, Name:  - 302 Type: tandem, Name:  - 39 Type: tandem, Name:  - 307 Type: tandem, Name:  - 40 Type: tandem, Name:  - 41 Type: tandem, Name:  - 303 TP0130 TP0126 TP0133 tprD, - TP0131 TP0132 TP0132 TP0127 exoA, - TP0125 TP0124 TP0123 TP0128 TP0129 TP0128
* Calculated from Protein Sequence

Gene ID: TP0127

DNA Molecule Name:
1  

Genbank ID:
3322394

Gene Name:


Definition:
hypothetical protein (member of large T.p. group)

Gene Start:
148595

Gene Stop:
149281

Gene Length:
687

Molecular Weight*:
24855

pI*:
7.79

Net Charge*:
1.85

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
This hypothetical protein appears to be paralogously related
to TP0619, TP0315, TP0618, TP0697, TP0617, TP0479,
TP0314, TP0698, TP0346, and TP0347, with BLAST scores ranging
from 150 for TP0619 to 42 for TP0347. E-values range from 5e-38
to 3e-05. The score of TP0127 compared to itself is 478.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MLGWGMDMSKSVMLCCLLSVQPCYAGYVFVSPKLGVYGEALGGPDTVGKA
VKQADGTKIAPKIWYYAPRTPLFGVDIGYQADNGLLFRVNLDAALTRLMF
RSQCVVGYSLRFGWGGGYVSIASGIECSATVDDAQYEPYTKNEQGTTVAS
NTVFPCTVLEALVRDPALTADYLLYGMQSCYAIPLHVGVSYYLAKRWGIE
CALTASLGISMRTDVRVPYAVRIGPVFRV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAGGATGGGGAATGGATATGTCCAAAAGTGTGATGCTGTGTTGCCT
GTTGAGTGTACAACCCTGTTATGCCGGGTACGTGTTTGTTTCCCCAAAGC
TTGGCGTGTATGGAGAAGCATTGGGCGGTCCTGACACGGTGGGTAAAGCG
GTCAAGCAGGCCGACGGTACTAAGATTGCTCCGAAGATATGGTACTACGC
GCCGCGTACCCCGCTTTTTGGCGTGGATATAGGCTATCAGGCGGATAACG
GCCTGTTGTTCCGGGTGAATTTGGATGCGGCACTCACGCGCCTTATGTTT
CGCAGCCAGTGTGTGGTGGGCTATTCCTTGCGGTTCGGCTGGGGGGGGGG
GTACGTCTCTATCGCTTCGGGAATCGAGTGTAGTGCAACGGTCGATGACG
CGCAGTACGAGCCCTACACGAAAAATGAGCAGGGGACTACTGTTGCCTCC
AACACCGTGTTCCCGTGCACGGTCTTGGAGGCATTGGTGCGTGATCCGGC
CCTTACCGCAGATTACCTGCTTTACGGTATGCAAAGCTGTTACGCAATTC
CGCTCCATGTGGGGGTTTCGTATTACCTTGCCAAGCGCTGGGGTATTGAG
TGTGCGCTTACGGCCTCACTTGGCATTTCAATGCGGACGGATGTGCGCGT
CCCCTACGCGGTACGCATAGGGCCGGTATTCCGCGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy