Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR100 IGR107 IGR102 IGR106 IGR101 IGR103 IGR104 IGR105 TP0132 TP0130 TP0126 tprD, - TP0131 TP0129 TP0127 exoA, - TP0125 TP0124 TP0123 TP0132 TP0130 TP0126 tprD, - TP0131 TP0129 TP0127 exoA, - TP0125 TP0124 TP0123 Type: tandem, Name:  - 41 Type: tandem, Name:  - 40 Type: tandem, Name:  - 303 Type: tandem, Name:  - 38 Type: tandem, Name:  - 307 Type: tandem, Name:  - 302 Type: tandem, Name:  - 39 Type: tandem, Name:  - 284 TP0132 TP0130 TP0126 tprD, - TP0131 TP0127 exoA, - TP0125 TP0124 TP0123 TP0128 TP0129 TP0128
* Calculated from Protein Sequence

Gene ID: TP0126

DNA Molecule Name:
1  

Genbank ID:
3322393

Gene Name:


Definition:
hypothetical protein

Gene Start:
148487

Gene Stop:
147615

Gene Length:
873

Molecular Weight*:
31907

pI*:
9.86

Net Charge*:
13.01

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0733, another
hypothetical protein. Residues 128-2556 are 32% similar to 00860.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
189  
216

PDB Hit:
none

Gene Protein Sequence:
MRTHDIPRSPLVGHKKNAAPDGIGASRACCPARENEPFKKGSTNSRGGGV
EWSRSSTRRVRGSALERGMKQLKWWAVGPVLGICAGVWGAAHPVHADPWD
TTAAGRSTIRLSAMGAVPLFQVDWCNSGRGDDRNANAQTNGHKYIYPAFS
AALGFEHFVCRGLSLGIDASVQYHCSYPNNTYSPTTPYYYLAIPVALTAG
YTVAFWRIRLPLTVGAGFNYQHYYTSTYYGLVLKAAAGCYFQLTEHWSLG
VSATYSGVPRSCEKIIEEDRQQTNTRTAQFIAAGVDVRYHL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGACGCACGACATACCCCGCAGTCCCCTCGTGGGGCATAAGAAAAA
CGCAGCTCCCGATGGCATAGGCGCCTCACGCGCGTGCTGCCCAGCGCGCG
AGAACGAACCCTTTAAAAAGGGTTCGACAAACAGCCGTGGGGGGGGGGTA
GAATGGAGTAGGTCCTCGACGAGACGCGTAAGAGGATCGGCGTTGGAGCG
GGGTATGAAACAATTGAAGTGGTGGGCGGTCGGCCCGGTGCTGGGAATAT
GCGCGGGAGTGTGGGGAGCTGCACACCCGGTGCACGCGGACCCGTGGGAC
ACTACTGCGGCGGGCCGGAGTACTATACGCCTTTCGGCCATGGGCGCGGT
GCCCCTCTTTCAAGTGGATTGGTGTAACAGCGGTCGCGGGGACGACCGTA
ATGCCAACGCGCAAACCAACGGGCACAAGTACATCTACCCCGCGTTCAGT
GCGGCGTTAGGGTTTGAACACTTTGTGTGCCGCGGCCTGTCGCTCGGGAT
TGACGCAAGTGTGCAGTACCATTGCAGCTATCCAAACAATACGTACAGTC
CCACTACTCCGTACTATTACCTTGCAATTCCCGTTGCCCTCACTGCCGGG
TACACGGTTGCCTTCTGGCGCATCCGCTTGCCACTGACGGTAGGGGCTGG
CTTCAATTATCAGCATTACTACACGTCTACCTACTACGGTCTTGTGCTCA
AGGCGGCAGCGGGGTGCTATTTTCAACTGACAGAGCACTGGTCCTTGGGG
GTAAGCGCCACGTACAGCGGCGTACCCCGGTCATGCGAAAAGATTATTGA
AGAAGATAGACAGCAGACCAACACGCGCACCGCACAGTTCATAGCCGCGG
GTGTGGACGTTCGCTACCACCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy