Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR100 IGR102 IGR106 IGR101 IGR99 IGR103 IGR104 IGR105 TP0130 TP0126 tprD, - TP0131 pckA, - TP0122 TP0129 TP0127 exoA, - TP0125 TP0124 TP0123 TP0130 TP0126 tprD, - TP0131 pckA, - TP0122 TP0129 TP0127 exoA, - TP0125 TP0124 TP0123 Type: tandem, Name:  - 284 Type: tandem, Name:  - 38 Type: tandem, Name:  - 303 Type: tandem, Name:  - 39 Type: tandem, Name:  - 40 Type: tandem, Name:  - 302 Type: tandem, Name:  - 307 TP0130 TP0126 tprD, - TP0131 pckA, - TP0122 TP0127 exoA, - TP0125 TP0124 TP0123 TP0128 TP0129 TP0128
* Calculated from Protein Sequence

Gene ID: TP0125

DNA Molecule Name:
1  

Genbank ID:
3322391

Gene Name:
exoA  

Definition:
exodeoxyribonuclease

Gene Start:
146754

Gene Stop:
147545

Gene Length:
792

Molecular Weight*:
29728

pI*:
6.74

Net Charge*:
-0.98

EC:
3.1.11.2  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
ExoA is involved in degradation of double-stranded DNA. It acts
progressively in a 3'- to 5'-direction, releasing 5'-phosphomonucleotides.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to exodeoxyribonuclease.
For example residues 6-258 are 43% similar to EXOA_BACSU, 3'-exo-
deoxyribonuclease of Bacillus subtilis, (accession# Z99124).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0708
COG name: Exonuclease III
Functional Class:  L
The phylogenetic pattern of COG0708 is a-t-y--cebrhuj--ol--X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 6-17, 32-43, 86-133, 151-182, and 210-237 are significant
(100%) hits to blocks (BL00726A,B,C,D,E), AP endonucleases family
1 proteins.

ProDom Summary:  Protein Domain Search
Residues 153-250 are 50% similar to EXODEOXYRIBONUCLEASE of EXOA_BACSU.
Residues 6-26, 30-92 and 99-142 support this hit.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 262 (E-value = 4e-56) place TP0125 in the Exo_endo_phos family which is described as Endonuclease/Exonuclease/phosphatase family (PF03372)

PDB Hit:
gi|2392164|pdb|1AKO| Exonuclease Iii From Escherichia Coli Nuclease, Exonuclease, Ap-Endonuclease, Dna Repair Mol_id: 1; Molecule: Exonuclease Iii; Chain: Null; Ec: 3.1.11.2; Engineered: Yes; Biological_unit: Monomer

Gene Protein Sequence:
MRPVQRIISWNVNGIRAIERKDFLSWLAREAPDVLCLQEIKAHESQLSAA
LRAPVWSAGAGGTYYTYFHSAQRPGYSGTALFSKRAPDAVRFFGVPAFDC
EGRMLAARFGELTVVSAYFPNAQEGGKRLAYKLDFCAAFRAFCDEERTAG
QHVILCGDYNIAHKEIDLAHPQENEGNPGFLPQERAWMDTFTEAGYADSF
RAFCTEGQQYTWWSYRARARARNIGWRIDYQCVDQAFLARVTSSQILSEV
TGSDHCPVCLTYAD

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTCCCGTGCAGCGTATCATATCTTGGAATGTGAATGGAATTCGTGC
CATAGAGCGGAAAGATTTTCTCAGCTGGCTCGCGCGTGAGGCGCCTGATG
TTCTCTGTTTGCAGGAGATTAAAGCGCATGAGTCGCAGCTGAGTGCTGCG
CTTCGTGCTCCGGTCTGGAGTGCTGGGGCGGGGGGTACGTACTATACCTA
TTTTCACAGTGCGCAGCGTCCTGGATACAGTGGCACGGCGCTGTTCAGTA
AGCGCGCGCCAGATGCGGTGCGTTTCTTCGGGGTTCCGGCTTTTGACTGC
GAGGGGCGGATGCTTGCGGCACGCTTTGGCGAGCTGACGGTGGTAAGCGC
GTATTTTCCGAATGCGCAGGAAGGGGGCAAGCGGCTCGCGTATAAGCTTG
ATTTTTGCGCAGCGTTTCGTGCGTTCTGTGATGAAGAGCGTACGGCCGGG
CAGCACGTGATCTTGTGTGGTGACTACAACATAGCGCATAAGGAAATCGA
CCTGGCACATCCTCAGGAAAATGAGGGGAATCCTGGATTCCTGCCTCAGG
AGCGTGCATGGATGGATACATTTACGGAGGCAGGCTATGCGGATAGCTTC
CGAGCCTTCTGCACAGAAGGGCAGCAGTACACGTGGTGGAGCTACCGTGC
CCGTGCACGCGCGCGTAACATTGGATGGCGCATCGATTACCAGTGTGTGG
ACCAAGCCTTTTTAGCGCGCGTGACCTCTTCGCAGATACTGTCCGAGGTG
ACAGGATCGGATCACTGCCCAGTGTGTTTGACGTACGCGGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy