Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR96 IGR100 IGR101 IGR95 IGR99 IGR97 IGR98 yaeE, - TP0119 TP0120 TP0118 pckA, - TP0122 exoA, - TP0125 TP0121 TP0124 TP0123 yaeE, - TP0119 TP0120 TP0118 pckA, - TP0122 exoA, - TP0125 TP0121 TP0124 TP0123 Type: tandem, Name:  - 37 Type: tandem, Name:  - 38 Type: tandem, Name:  - 284 yaeE, - TP0119 TP0120 TP0118 pckA, - TP0122 exoA, - TP0125 TP0121 TP0124 TP0123
* Calculated from Protein Sequence

Gene ID: TP0122

DNA Molecule Name:
1  

Genbank ID:
3322386

Gene Name:
pckA  

Definition:
phosphoenolpyruvate carboxykinase

Gene Start:
142881

Gene Stop:
141028

Gene Length:
1854

Molecular Weight*:
68117

pI*:
6.61

Net Charge*:
-3.34

EC:
4.1.1.32  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Pyruvate metabolism

Comment:
Reaction:
GTP + OXALOACETATE = GDP + PHOSPHOENOLPYRUVATE + CO(2).

Blast Summary:  PSI-Blast Search
There are many significant hits to many phosphoenolpyruvate carboxykinase
proteins in the database. For example residues 5-606 are 51% similar to
PPCC_RAT, phosphoenolpyruvate carboxykinase of Rattus norvegicus,
(accession# K03248). Residues 8-605 are 55% similar to the
pckA protein of M.leprae (Z95398).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1274
COG name: Phosphoenolpyruvate carboxykinase
Functional Class:  C
The phylogenetic pattern of COG1274 is ---k------r------lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 55-88, 90-133, 134-153, 165-176, 188-219, 236-260, 287-328,
329-351, 368-410, 204-246, 436-481, 493-530, 537-553, and 349-365
represent significant (100%) hits to blocks (BL00505A,B,C,D,E,F,G,
H,I,J,K,L), Phosphoenolpyruvate carboxykinase (GTP) proteins.

ProDom Summary:  Protein Domain Search
Residues 14-553 are 59% similar to phosphoenolpyruvate carboxykinase
of PPCK_NEOFR.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MELHEIAHARAKAWIEEMVALCAPDTVYVCDGSKKEYDTIMQKMVDAGLA
TPLKKRKNCFLFRSQPSDVARVEARTFIASKREDDAGPTNHWTDPAELKK
TMTGLYSQCMKGRTMYVIPFSMGPVGSPISKNGIEITDSEYVVCNMHIMT
RVGTRVLEALGTDGEFVPCLHSVGKPLGPGVTDAGQWPCADMERKYISHF
PEERLVWSFGSGYGGNALLGKKCFALRIASVLARDEGWLAEHMLILKITN
PAGKTKYIGAAFPSACGKTNLAMMIPTLPGWKVETVGDDIAWMKFGKDGR
LYAINPEAGFFGVAPGTSDFSNKNAMDSIKENAIFTNCGLTEDGDVWWEG
IGYPAKGTIIDWHGVSRPAPTRDKSPKGEEIAHPNARFTAPARQCPAIAS
NWEDPEGVPIDAFLFGGRRPSTVPLVHQARDWNHGVFLGSIIGSEVTAAV
ISDQVGQIRRDPFAMLPFCGYHMADYFSHWIKLGSQARAENLPKIFCVNW
FRKDAEGNFLWPGYGDNSRVLAWIFDRCDGVDNAVETAIGWMPKEGALNT
EGLNVSTQAVKELLSVDIAGWKKEIKDIRENHYPKFGARLPQQLRDALEV
LEARINGSEGAACTRDMC

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACTTCACGAGATTGCCCACGCTCGAGCAAAGGCGTGGATAGAAGA
GATGGTCGCACTCTGTGCCCCAGATACCGTCTACGTCTGCGACGGTTCGA
AAAAAGAGTACGACACCATTATGCAGAAAATGGTGGATGCTGGCTTGGCT
ACCCCATTAAAAAAACGTAAGAACTGCTTCCTCTTTCGCTCACAGCCCTC
CGACGTTGCGCGCGTCGAAGCGCGCACCTTCATCGCCTCAAAAAGGGAGG
ATGATGCAGGACCCACTAACCATTGGACCGATCCTGCAGAATTAAAAAAG
ACTATGACCGGTCTCTATTCCCAGTGCATGAAGGGCCGTACCATGTACGT
CATTCCCTTTTCCATGGGACCGGTCGGCTCACCCATCTCTAAAAATGGCA
TCGAAATCACCGATTCTGAGTACGTCGTTTGCAACATGCACATCATGACA
CGCGTGGGTACCCGCGTGCTTGAGGCGTTGGGTACTGATGGTGAGTTCGT
CCCCTGTTTGCACTCTGTGGGGAAGCCGTTAGGACCGGGCGTAACTGACG
CAGGCCAGTGGCCCTGCGCGGATATGGAGCGCAAATACATCTCTCACTTT
CCTGAAGAGCGCTTGGTTTGGTCTTTCGGTTCAGGATACGGAGGGAATGC
CCTGTTGGGGAAAAAGTGTTTCGCATTACGCATCGCTTCAGTACTCGCAC
GAGACGAAGGGTGGCTTGCAGAGCACATGCTCATCCTTAAAATCACCAAC
CCTGCTGGAAAGACCAAGTACATTGGTGCGGCGTTTCCCTCTGCATGTGG
CAAAACGAATCTGGCTATGATGATCCCTACCCTTCCTGGATGGAAGGTCG
AGACCGTAGGCGATGACATCGCGTGGATGAAATTCGGAAAGGACGGCCGC
CTGTACGCTATCAATCCTGAAGCGGGGTTCTTCGGCGTAGCACCAGGGAC
ATCTGATTTCTCGAACAAGAATGCCATGGACTCTATCAAGGAAAACGCCA
TTTTCACCAACTGTGGTCTGACCGAAGACGGCGACGTGTGGTGGGAGGGT
ATCGGCTATCCCGCTAAAGGAACAATCATTGATTGGCACGGCGTGTCGCG
CCCCGCACCTACACGCGATAAAAGTCCAAAAGGAGAAGAAATTGCGCATC
CGAATGCGCGTTTTACCGCTCCTGCGCGACAGTGCCCTGCAATTGCAAGT
AACTGGGAAGATCCCGAAGGGGTCCCTATCGACGCTTTTCTGTTTGGCGG
CCGTCGCCCCAGTACGGTTCCCCTGGTGCATCAGGCCCGGGACTGGAATC
ACGGGGTGTTTCTAGGTTCCATCATCGGCTCGGAGGTAACTGCAGCAGTT
ATCTCTGACCAGGTAGGTCAGATTCGCCGAGACCCGTTCGCGATGCTCCC
CTTCTGCGGCTACCATATGGCAGACTACTTTTCGCACTGGATTAAGCTCG
GATCGCAGGCACGTGCCGAAAACCTGCCAAAGATTTTCTGCGTTAACTGG
TTTCGTAAAGATGCAGAGGGCAACTTCCTGTGGCCCGGATATGGCGATAA
CAGCCGAGTACTCGCGTGGATCTTTGACCGCTGTGATGGTGTGGACAACG
CGGTGGAAACAGCGATCGGTTGGATGCCCAAAGAGGGAGCCTTGAACACA
GAGGGGTTAAACGTAAGCACGCAGGCAGTGAAAGAGCTTTTGTCGGTGGA
CATAGCCGGATGGAAAAAGGAAATTAAAGACATCCGAGAGAATCACTACC
CAAAGTTTGGCGCGCGGCTGCCACAGCAGCTTCGCGATGCACTCGAGGTT
TTGGAAGCTCGCATCAACGGCAGCGAGGGGGCTGCGTGCACGCGTGATAT
GTGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy