Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR88 IGR90 IGR91 IGR93 IGR94 IGR89 IGR92 thiD, - TP0115 TP0118 pepC, - TP0112 tprC, - TP0117 hflK, - TP0113 hflC, - TP0114 rpoN, - TP0111 uvrB, - TP0116 thiD, - TP0115 TP0118 pepC, - TP0112 tprC, - TP0117 hflK, - TP0113 hflC, - TP0114 rpoN, - TP0111 uvrB, - TP0116 Type: tandem, Name:  - 36 Type: tandem, Name:  - 33 Type: tandem, Name:  - 34 Type: tandem, Name:  - 35 thiD, - TP0115 TP0118 pepC, - TP0112 tprC, - TP0117 hflK, - TP0113 hflC, - TP0114 rpoN, - TP0111 uvrB, - TP0116
* Calculated from Protein Sequence

Gene ID: TP0115

DNA Molecule Name:
1  

Genbank ID:
3322378

Gene Name:
thiD  

Definition:
phosphomethylpyrimidine kinase

Gene Start:
132712

Gene Stop:
131906

Gene Length:
807

Molecular Weight*:
28929

pI*:
6.89

Net Charge*:
-0.59

EC:
2.7.4.7  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Campobasso N, Mathews II, Begley TP, Ealick SE.
Crystal structure of 4-methyl-5-beta-hydroxyethylthiazole kinase from Bacillus subtilis at 1.5 A resolution.
Biochemistry. 2000 Jul;39(27):7868-77.
PMID: 10891066

Mizote T, Tsuda M, Smith DD, Nakayama H, Nakazawa T.
Cloning and characterization of the thiD/J gene of Escherichia coli encoding a thiamin-synthesizing bifunctional enzyme, hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase.
Microbiology. 1999 Feb;145 ( Pt 2):495-501.
PMID: 10075431

Campobasso N, Mathews II, Begley TP, Ealick SE.
Crystal structure of 4-methyl-5-beta-hydroxyethylthiazole kinase from Bacillus subtilis at 1.5 A resolution.
Biochemistry. 2000 Jul;39(27):7868-77.
PMID: 10891066

Ouzounis CA, Kyrpides NC.
ThiD-TenA: a gene pair fusion in eukaryotes.
J Mol Evol. 1997 Dec;45(6):708-11.
PMID: 9419250

Comment:
This protein is involved in thiamin biosynthesis.

Reaction:
ATP + 4-AMINO-2-METHYL-5-PHOSPHOMETHYLPYRIMIDINE =
ADP + 4-AMINO-2- METHYL-5-DIPHOSPHOMETHYLPYRIMIDINE.

Blast Summary:  PSI-Blast Search
There were many significant hits to phosphomethylpyrimidine kinases in
the nr database. For example residues 2-263 were 28% similar to the
predicted phosphomethylpyrimidine kinase of Bacillus subtilis,
(accession# Z99110).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0351
COG name: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
Functional Class:? H
The phylogenetic pattern of COG0351 is amtkYqv-eBrhuj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-95 are 38% similar to phosphomethylpyrimidine kinase of
YWDB_BACSU. Residues 153-196 and 200-257 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MVKLLSIGGSDASGGAGIEADLKTFQEYGAFGVATLTAIVTMDPSRNWSH
RVHSLEEDCVRDQLETAFAGVGVSAVKSGMLASVHAIECVAEYLERFAVA
AYVFDPVMVCKGSGDALHRELNELMIQKLLPRATVVTPNLFETAQIAGIS
VPRTVDEMKEGARLIHERGASHVFVKGGGRLPGCKHALDVFYDGKTFHLV
EDELVQSGWNHGAGCTVSAAITAGLGRGLTAYDAILSAKRFVTTGLRHGF
QVNQWVGTGNLSKWRDRFH

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTCAAGTTGCTTAGCATTGGTGGATCGGATGCTTCAGGTGGTGCGGG
CATCGAGGCGGATCTGAAAACTTTCCAAGAGTATGGAGCGTTCGGTGTGG
CTACGCTCACCGCCATCGTTACTATGGACCCATCCCGGAACTGGTCGCAT
CGTGTACATTCACTTGAGGAAGACTGTGTGCGCGATCAGCTTGAAACCGC
ATTTGCAGGCGTGGGGGTCAGCGCGGTGAAAAGCGGTATGCTTGCCTCTG
TCCATGCAATCGAATGTGTCGCGGAGTATCTCGAACGTTTTGCAGTTGCT
GCATACGTCTTTGATCCTGTCATGGTATGCAAAGGATCGGGAGATGCATT
GCACCGTGAGTTGAACGAATTGATGATCCAGAAACTTTTGCCACGCGCGA
CAGTTGTTACTCCCAATCTTTTTGAAACCGCCCAGATTGCCGGTATCAGC
GTACCACGGACAGTGGACGAAATGAAGGAGGGTGCACGTTTGATTCACGA
GCGCGGCGCGTCGCACGTGTTCGTCAAAGGCGGCGGAAGACTCCCCGGTT
GCAAGCACGCTCTGGATGTTTTCTACGACGGCAAGACGTTTCACCTCGTT
GAAGATGAACTTGTGCAGAGTGGATGGAATCACGGCGCGGGCTGCACCGT
ATCTGCGGCTATTACTGCAGGACTGGGCCGAGGACTCACCGCCTACGACG
CGATACTGAGTGCTAAGAGATTCGTGACTACAGGCCTCCGCCACGGATTC
CAAGTCAACCAGTGGGTTGGAACAGGAAACCTCAGCAAATGGCGCGACCG
CTTCCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy