Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR79 IGR80 IGR82 IGR78 IGR81 smbA,pyrH, - TP0099 rep, - TP0102 ccdA, - TP0101 ushA, - TP0104 recQ, - TP0103 polA, - TP0105 smbA,pyrH, - TP0099 rep, - TP0102 ccdA, - TP0101 ushA, - TP0104 recQ, - TP0103 polA, - TP0105 Type: tandem, Name:  - 28 Type: tandem, Name:  - 25 Type: tandem, Name:  - 283 Type: tandem, Name:  - 26 Type: tandem, Name:  - 27 Type: tandem, Name:  - 29 smbA,pyrH, - TP0099 rep, - TP0102 ccdA, - TP0101 ushA, - TP0104 recQ, - TP0103 polA, - TP0105 cycY, - TP0100 cycY, - TP0100
* Calculated from Protein Sequence

Gene ID: TP0103

DNA Molecule Name:
1  

Genbank ID:
3322364

Gene Name:
recQ  

Definition:
ATP-dependent DNA helicase

Gene Start:
111788

Gene Stop:
113608

Gene Length:
1821

Molecular Weight*:
67277

pI*:
8.04

Net Charge*:
10.71

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Folate biosynthesis
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Wu L, Davies SL, Hickson ID.
Roles of RecQ family helicases in the maintenance of genome stability.
Cold Spring Harb Symp Quant Biol. 2000;65:573-81.
PMID: 12760076

Hickson ID.
RecQ helicases: caretakers of the genome.
Nat Rev Cancer. 2003 Mar;3(3):169-78.
PMID: 12612652

Cobb JA, Bjergbaek L, Gasser SM.
RecQ helicases: at the heart of genetic stability.
FEBS Lett. 2002 Oct;529(1):43-8.
PMID: 12354611

Comment:
RecQ is involved in the RecF recombination pathway; its gene expression
is under the regulation of the SOS system. It is a DNA helicase.

See TP0003, RecF.
See TP0442, RecN.
See TP0687, RecG.
See TP0692, RecA.
See TP0704, RecJ.
See TP1004, RecR.

Blast Summary:  PSI-Blast Search
There are several significant hits to RecQ proteins. For example
residues 119-603 are 28% similar to RECQ_HAEIN, DNA-dependent
ATPase, DNA helicase (recQ) of Haemophilus influenzae, (accession#
U32756). In addition there were hits to other DNA Helicases and
some mammalian Werner syndrome genes.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0514
COG name: Superfamily II DNA helicases, RecQ family
Functional Class:? L
The phylogenetic pattern of COG0514 is ----y--ceB-h-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 282-291 represent a significant (99%) hit to blocks (BL00690B),
DEAH-box subfamily ATP-dependent helicases proteins. Residues 103-146,
282-295, 579-607, 150-201, 380-431, and 437-479 represent significant
(99%) hit to blocks (BL00039A,C,D,E,F), DEAD-box subfamily ATP-dependent
helicases proteins.

ProDom Summary:  Protein Domain Search
Residues 261-351 are 41% similar to ATP-DEPENDENT DNA HELICASE of
RECQ_BACSU. Residues 145-207 also match well with ATP-DEPENDENT
DNA HELICASE of RECQ_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0770, ATP-dependent RNA
helicase, TP0344, transcription-repair coupling factor (trcF) and
TP0687, DNA recombinase (recG). Residues 378-491 are 24% similar to
TP0770. Residues in this region were also significantly similar to
TP0344 and TP0687.

Pfam Summary:  Pfam Search
Residues 46 to 357 (E-value = 1.1e-08) place TP0103 in the DEAD family which is described as DEAD/DEAH box helicase (PF00270)
Residues 395 to 471 (E-value = 2.3e-22) place TP0103 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)

PDB Hit:
none

Gene Protein Sequence:
MGNTSDWVEMDGLRYVYAAQGAAPMPAPTDNPACDAHMSHDVIARTAQAV
FGIRALFPWQRLVIANILDAAHACTHTTPFAAAGSSQTDATRVTHVDDAQ
PEDNFVGAMQDTRFDQDGVSRAHQVVLLPTGAGKSLCFQVPALFLEGPTL
VVYPLLSLMRDQCRRMQAVGFSVILLRGGLNAQERAYMYAQLDRCAEAYG
RMRGVTPPAHQTAEFSLADSISFDASLFSDDVSTFSKVVHVDERLAQKRT
ESRRGVCIIASPEILTQPALRARVRACRVAHLVIDEAHCVSEWGDSFRPD
YVRLGELVQDLAPQVVTAFTATASQTVLARIMEVLFGGRAHVLQGTVDRP
NIRYTVRTVLCKQTALTQLVARCVRPAVIFCARRVQVERVAHHLRTCLSD
TQIRFYHAGLQREEKETVERWFHTHDSAVLVTTCAWGMGVDKPNVRTVIH
VDAPLTVEAYVQEVGRAGRDGMRADAFLLWSPRDARSIETLPHAQRVRAH
VLRHFAESGRCRRAVLLESLGEQNVCAGCDVCAGTARFVCEDVEALLQFL
KKNARRFTVSSLVQHLALHQKVLSVADVRALLYYALETGRVKKKHSLLWG
DVLYVAR

Gene Nucleotide Sequence:  Sequence Viewer
GTGGGTAATACTTCAGATTGGGTAGAGATGGATGGATTGCGCTATGTGTA
TGCCGCGCAGGGTGCGGCCCCCATGCCTGCTCCTACGGATAATCCTGCTT
GTGATGCGCACATGTCGCATGACGTCATAGCGCGTACTGCCCAAGCAGTT
TTTGGTATTCGTGCGCTGTTTCCTTGGCAGCGCTTGGTAATTGCTAACAT
ACTGGATGCGGCGCATGCGTGTACACATACAACTCCGTTCGCTGCGGCAG
GTTCTTCTCAAACCGATGCTACGAGGGTGACTCATGTGGATGACGCGCAG
CCTGAGGATAATTTCGTCGGTGCCATGCAAGACACACGTTTTGATCAGGA
TGGCGTGTCACGCGCACATCAAGTGGTGCTATTGCCGACAGGTGCAGGAA
AATCGCTGTGTTTTCAAGTACCTGCCCTCTTTTTAGAGGGGCCGACGCTA
GTGGTGTACCCACTGTTATCGCTCATGCGTGATCAGTGCCGTCGGATGCA
GGCAGTGGGATTTTCGGTCATCTTGTTACGTGGTGGACTGAATGCGCAAG
AGCGCGCGTACATGTATGCGCAGTTGGATAGGTGTGCTGAGGCGTATGGC
CGGATGCGAGGCGTTACGCCTCCTGCACACCAGACGGCAGAATTTTCCCT
TGCAGATTCGATCTCTTTTGATGCGTCACTCTTCTCTGATGACGTGAGTA
CCTTCTCGAAGGTGGTACATGTGGATGAACGTCTTGCTCAGAAAAGGACA
GAAAGTCGAAGAGGTGTATGCATCATCGCAAGTCCAGAGATACTCACACA
ACCTGCGCTGCGCGCACGCGTGCGTGCATGTCGCGTTGCGCATTTGGTTA
TTGATGAAGCGCACTGTGTGTCCGAGTGGGGAGATTCGTTTCGTCCTGAT
TACGTGCGACTAGGCGAATTGGTGCAGGATCTTGCGCCTCAAGTGGTGAC
TGCATTTACGGCGACTGCAAGTCAAACAGTGCTTGCGCGCATCATGGAAG
TGCTGTTTGGCGGTCGTGCGCACGTGTTGCAGGGAACAGTAGATCGCCCG
AACATTCGATACACCGTACGCACGGTGCTGTGTAAGCAGACGGCACTGAC
TCAACTTGTAGCGCGTTGTGTGCGCCCTGCAGTTATTTTTTGTGCTCGTC
GGGTACAGGTGGAGCGTGTAGCCCACCATTTGCGCACGTGTCTTTCTGAC
ACACAGATACGTTTTTATCACGCAGGGTTGCAGAGGGAAGAAAAAGAAAC
AGTGGAGCGATGGTTTCATACCCATGATTCTGCCGTTTTGGTAACTACTT
GCGCGTGGGGAATGGGAGTTGATAAGCCGAATGTACGTACGGTCATTCAC
GTGGATGCGCCACTGACTGTGGAGGCGTACGTACAGGAGGTTGGAAGAGC
AGGACGGGACGGAATGCGTGCAGACGCATTTTTATTGTGGTCACCTCGAG
ATGCTCGCTCGATAGAAACACTGCCGCATGCACAACGGGTGCGTGCGCAC
GTGTTGCGCCACTTTGCTGAAAGCGGACGTTGTCGCCGCGCAGTTTTACT
TGAGTCTTTGGGGGAACAGAATGTGTGTGCCGGATGTGATGTGTGTGCAG
GCACTGCACGTTTTGTATGTGAGGATGTAGAAGCGCTCTTACAGTTTTTG
AAAAAGAATGCGCGCAGATTCACTGTATCATCGTTGGTGCAGCACCTCGC
GCTACATCAGAAAGTGCTCAGTGTGGCGGATGTACGTGCCTTGCTATATT
ACGCGCTCGAAACAGGACGTGTGAAAAAAAAACATTCACTCTTGTGGGGT
GATGTCCTGTATGTTGCACGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy