Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR77 IGR79 IGR80 IGR76 IGR74 IGR82 IGR75 IGR78 IGR81 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 rep, - TP0102 infA, - TP0097 ccdA, - TP0101 ushA, - TP0104 recQ, - TP0103 TP0095 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 rep, - TP0102 infA, - TP0097 ccdA, - TP0101 ushA, - TP0104 recQ, - TP0103 TP0095 Type: tandem, Name:  - 28 Type: tandem, Name:  - 25 Type: tandem, Name:  - 230 Type: tandem, Name:  - 26 Type: tandem, Name:  - 27 Type: tandem, Name:  - 29 Type: tandem, Name:  - 283 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 rep, - TP0102 infA, - TP0097 ccdA, - TP0101 ushA, - TP0104 recQ, - TP0103 TP0095 cycY, - TP0100 cycY, - TP0100
* Calculated from Protein Sequence

Gene ID: TP0102

DNA Molecule Name:
1  

Genbank ID:
3322363

Gene Name:
rep  

Definition:
DNA helicase II

Gene Start:
111723

Gene Stop:
109753

Gene Length:
1971

Molecular Weight*:
75454

pI*:
8.38

Net Charge*:
9.09

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Folate biosynthesis
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Cheng W, Brendza KM, Gauss GH, Korolev S, Waksman G, Lohman TM.
The 2B domain of the Escherichia coli Rep protein is not required for DNA helicase activity.
Proc Natl Acad Sci U S A. 2002 Dec;99(25):16006-11.
PMID: 12441398

Noirot-Gros MF, Soultanas P, Wigley DB, Ehrlich SD, Noirot P, Petit MA.
The beta-propeller protein YxaL increases the processivity of the PcrA helicase.
Mol Genet Genomics. 2002 May;267(3):391-400.
PMID: 12073041

Petit MA, Ehrlich D.
Essential bacterial helicases that counteract the toxicity of recombination proteins.
EMBO J. 2002 Jun;21(12):3137-47.
PMID: 12065426

Soultanas P, Wigley DB.
DNA helicases: 'inching forward'.
Curr Opin Struct Biol. 2000 Feb;10(1):124-8.
PMID: 10679457

Comment:
Rep helicase is a single-stranded DNA-dependent ATPase involved in DNA
replication; it can initiate unwinding at a nick in the DNA. It binds
the single-stranded DNA and acts in a progressive fashion along the 3'
to 5' direction.

Blast Summary:  PSI-Blast Search
There are many significant hits to DNA helicases. For example residues
1-651 are 34% similar to DNA helicase II of Serratia marcescens,
(accession# AF028736).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0210
COG name: Superfamily I DNA and RNA helicases
Functional Class:? L
The phylogenetic pattern of COG0210 is --T-YqvCEBRHUJgPOLinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 284-386 are 43% similar to ATP-DEPENDENT HELICASE on PCRA_STAAU.
Residues 9-68, 81-200, 203-242, 243-282, 284-386, 544-565 and 544-601
also match ATP-DEPENDENT HELICASES.

Paralogs:  Local Blast Search
This protein is paralogously related to TP1028 DNA helicase II (uvrD)
and TP0898 ATP-dependent nuclease, subunit A. Residues 2-636 are 33%
similar to TP1028. Residues 4-140, 172-300 and 542-597 are significantly
matched to TP0898.

Pfam Summary:  Pfam Search
Residues 5 to 477 (E-value = 4.8e-223) place TP0102 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

PDB Hit:
gi|2781090|pdb|1PJR| Structure Of Dna Helicase Dna Repair, Dna Replication, Sos Response, Helicase, Atp-Binding, Dna-Binding Mol_id: 1; Molecule: Pcra; Chain: Null; Engineered: Yes

Gene Protein Sequence:
MLSTLNPEQRRAVTTLEGPLLIIAGAGSGKTRVITARIAYMLECGILQSR
ILALTFTNKAAHEMSERIKALTGKPLRNTTVSTFHAFGVTILREHIHVLG
WRKNFSIYDENDKRALIREAAKEVHLLPEVLDTNCVSTLFSAIKMQRKNL
KELQHKERALWHEYHTALKLFNAVDFDDLIVLPIQIFSEYPDILASYKSR
YHYILVDEFQDTSAQQYRLMKMLATQNICVVGDDDQSIYSWRGAHHDNIL
SFEKDFPYATEITLEQNYRSTGTILAAANGVIAHNTQRKEKALWSGNDSG
KPIEIFNPETERDEAIFIANTILAEQIRASYSFSSFGVLLRTNSFMRIIE
DVFLQENIPYRVSGGMSFFQRKEIKDVLSYLRVISNPDDDVNLLRIINTP
RRGIGKKTLHLVSDIANTQQCSVFNALNQIINKTHAVDLKESHRTAVENF
LQLITQARTHLLSGKNLAYKVRKFVEDIQYFNYLIQEFQKNEHAARFKFL
QIEHLVESIEHWEQSSEHGSLYDYLNRVTLLARDNVQKETEGAVSLMTIH
ASKGLEFPVVFIAGVEAGTIPHERSIEEVHSIEEERRLFYVAITRAKEKL
YLTHCRTRKRGGKREERTASPFLDEIPKHLVRAHAPEGKISEEEVTRAFT
RIKKLFT

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTCTACACTTAATCCTGAGCAACGTCGAGCCGTTACCACACTTGA
GGGACCGCTTCTCATTATCGCCGGCGCAGGCTCAGGGAAAACGCGCGTAA
TCACGGCGCGCATCGCGTATATGCTCGAATGCGGTATTCTGCAATCGCGC
ATTCTTGCACTGACCTTCACTAACAAGGCCGCACACGAGATGTCTGAACG
TATTAAAGCTCTCACGGGCAAACCTTTACGCAACACGACCGTCAGTACTT
TTCACGCTTTTGGCGTTACGATTTTGCGAGAACATATCCATGTTCTCGGC
TGGAGGAAGAACTTTAGCATTTATGATGAAAATGATAAACGTGCTCTCAT
TCGCGAAGCAGCAAAGGAAGTACATCTCCTGCCAGAAGTTCTTGACACAA
ACTGCGTGAGCACGCTCTTTTCCGCTATTAAAATGCAGCGTAAGAACTTA
AAAGAGCTACAGCACAAGGAACGTGCTCTTTGGCACGAATATCATACTGC
GTTGAAATTATTTAATGCGGTAGACTTTGACGATTTGATCGTACTGCCAA
TCCAGATCTTCAGTGAATATCCTGATATCCTTGCTTCATATAAGAGTCGC
TATCATTACATTTTAGTGGATGAATTCCAAGACACCAGTGCACAGCAGTA
CCGTTTAATGAAAATGCTCGCTACACAAAATATCTGTGTAGTAGGGGACG
ATGATCAATCAATTTATTCTTGGCGTGGAGCACACCACGACAATATTCTC
TCTTTTGAAAAAGACTTCCCCTACGCCACAGAAATTACCTTAGAGCAAAA
TTACCGTTCCACCGGAACTATTTTGGCTGCCGCAAATGGCGTTATCGCAC
ACAATACACAACGCAAGGAAAAGGCACTGTGGTCCGGTAACGATTCAGGA
AAACCTATTGAAATCTTCAATCCCGAAACGGAACGTGATGAAGCAATCTT
TATTGCAAACACGATTCTCGCAGAACAAATACGCGCATCCTATTCTTTCA
GTAGTTTTGGAGTCCTACTCCGCACGAATAGTTTTATGCGCATAATTGAA
GACGTATTTTTGCAAGAAAATATTCCATACCGTGTCTCAGGCGGCATGAG
CTTTTTTCAGAGGAAAGAAATAAAGGATGTGCTCAGTTATCTGCGGGTAA
TTTCTAATCCTGACGACGATGTCAACCTATTACGCATCATTAATACCCCG
AGGCGAGGAATTGGAAAAAAAACACTGCATCTAGTCTCCGACATTGCTAA
TACACAACAATGTTCCGTGTTCAATGCACTGAATCAAATTATCAATAAAA
CACATGCAGTCGATTTAAAAGAATCACATCGTACCGCTGTGGAAAATTTT
CTCCAGCTCATTACCCAGGCGCGTACCCATCTACTTTCGGGGAAAAATCT
TGCGTACAAGGTACGCAAATTTGTTGAAGACATTCAGTATTTTAATTACC
TCATCCAAGAATTCCAAAAAAACGAACATGCCGCACGTTTTAAATTCTTG
CAAATCGAACACTTAGTCGAATCCATCGAACACTGGGAACAGAGTTCAGA
ACACGGAAGCTTGTACGACTACCTAAACCGCGTTACGTTGCTAGCACGCG
ATAACGTCCAAAAAGAAACAGAGGGCGCTGTGTCGCTCATGACAATTCAT
GCGTCGAAGGGGCTGGAATTTCCCGTAGTGTTTATCGCCGGCGTGGAAGC
GGGAACCATTCCACACGAACGAAGTATAGAAGAGGTTCACAGCATCGAGG
AAGAACGACGCCTTTTCTACGTTGCAATTACCCGCGCAAAAGAGAAGTTG
TACCTGACACACTGCCGCACAAGGAAACGCGGCGGAAAAAGGGAAGAGCG
CACCGCCTCCCCCTTTCTGGACGAAATTCCCAAACACCTGGTGCGCGCCC
ATGCACCGGAAGGAAAAATAAGCGAGGAAGAGGTCACGCGGGCCTTCACA
CGCATCAAAAAACTATTTACG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy