Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR73 IGR77 IGR79 IGR80 IGR76 IGR74 IGR72 IGR75 IGR78 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 rep, - TP0102 infA, - TP0097 ccdA, - TP0101 pta, - TP0094 recQ, - TP0103 TP0095 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 rep, - TP0102 infA, - TP0097 ccdA, - TP0101 pta, - TP0094 recQ, - TP0103 TP0095 Type: tandem, Name:  - 229 Type: tandem, Name:  - 24 Type: tandem, Name:  - 283 Type: tandem, Name:  - 25 Type: tandem, Name:  - 26 Type: tandem, Name:  - 230 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 rep, - TP0102 infA, - TP0097 ccdA, - TP0101 pta, - TP0094 recQ, - TP0103 TP0095 cycY, - TP0100 cycY, - TP0100
* Calculated from Protein Sequence

Gene ID: TP0099

DNA Molecule Name:
1  

Genbank ID:
3322360

Gene Name:
smbA  pyrH  

Definition:
uridylate kinase

Gene Start:
108128

Gene Stop:
107376

Gene Length:
753

Molecular Weight*:
27284

pI*:
6.15

Net Charge*:
-2.18

EC:
2.7.4.-  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Reaction: ATP + UMP = ADP + UDP.

PSI-BLAST converges to delta 1-pyrroline-5-carboxylate synthetase
proteins (proB, glutamate kinase) but TP0351 is proB also. The
convergence to proB may be reflecting the kinase domain.

Blast Summary:  PSI-Blast Search
The first run of gapped-BLAST shows many significant hits to uridylate
kinase. For example residues 1-250 are 35% similar to uridylate kinase
(smbA) of Borrelia burgdorferi, (accession# AE001158). However after
seven iterations of PSI-BLAST delta 1-pyrroline-5-carboxylate
synthetase proteins emerge. For example residues 2-249 are 19%
similar to delta 1-pyrroline-5-carboxylate synthetase of Lycopersicon
esculentum, (accession# U60267).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0528
COG name: Uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0528 is amtk-qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 4-14 and 151-205 represent a significant (99%) hit to blocks
(BL00324A,B), Aspartokinase proteins. Residues 144-177 and 198-230
represent a significant (96%) hit to blocks (BL00902C,D), Glutamate
5-kinase proteins.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 229 (E-value = 3.3e-38) place TP0099 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
13

PDB Hit:
none

Gene Protein Sequence:
MVTVLSLGGSIVAPETPDIELLGRFVRSVQRYLYEDASRKLIVVSGGGAP
ARTYQNAYRALRRSLSSPACAKPAHEGDNQEDRELYATAEHVELDWIGIM
ATRLNAQLLKSLFGILCPNPVVYDPTAANVFSGQVLVAAGWKPGFSTDTD
AVLLAERYSAKTVINLSDVAHVYTGDPRSDKDAKALTSLSWDDFLLLVDK
EWVPGSHVPFDPVASVRAKKSGIQVICATGRDLPNLERILNRQEFVGTTI
G

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTCACCGTTCTGTCACTTGGAGGTTCCATCGTTGCGCCTGAGACGCC
CGACATAGAGCTTCTCGGGCGGTTCGTTCGTTCCGTTCAACGGTACCTAT
ACGAAGACGCCTCACGGAAGCTCATTGTCGTTTCAGGCGGTGGTGCACCT
GCGCGCACTTATCAAAACGCCTATCGTGCGCTACGCCGGAGCCTGTCTTC
TCCGGCCTGTGCGAAACCTGCGCACGAGGGCGATAATCAGGAAGACAGGG
AGCTGTATGCCACGGCCGAACACGTTGAACTTGACTGGATTGGCATCATG
GCTACGCGTTTGAACGCGCAGCTGCTCAAATCCCTTTTTGGAATCCTTTG
TCCAAATCCGGTCGTGTATGACCCGACTGCGGCGAACGTTTTTTCAGGTC
AGGTGCTCGTTGCTGCTGGTTGGAAACCGGGTTTTTCCACCGACACCGAC
GCTGTGCTCCTTGCAGAGCGTTATTCTGCAAAGACGGTTATTAACCTTTC
CGACGTTGCGCATGTGTACACGGGGGATCCTCGTTCAGACAAGGATGCGA
AGGCGCTCACATCCCTCTCCTGGGATGATTTCCTCCTCCTTGTCGACAAG
GAGTGGGTACCGGGCAGCCATGTCCCCTTTGACCCAGTCGCTAGTGTCCG
GGCAAAAAAGTCGGGAATTCAGGTCATTTGCGCAACAGGGCGTGACTTAC
CGAATTTGGAGCGCATCCTGAACAGGCAAGAGTTCGTGGGGACCACCATT
GGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy