Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR73 IGR77 IGR76 IGR71 IGR74 IGR69 IGR72 IGR75 IGR70 IGR78 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 murB, - TP0090 TP0089 infA, - TP0097 cycY, - TP0100 TP0093 pta, - TP0094 cysS, - TP0091 TP0095 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 murB, - TP0090 TP0089 infA, - TP0097 cycY, - TP0100 TP0093 pta, - TP0094 cysS, - TP0091 TP0095 Type: tandem, Name:  - 229 Type: tandem, Name:  - 24 Type: tandem, Name:  - 283 Type: tandem, Name:  - 227 Type: tandem, Name:  - 228 Type: tandem, Name:  - 230 TP0096 dnaJ, - TP0098 smbA,pyrH, - TP0099 murB, - TP0090 TP0089 infA, - TP0097 cycY, - TP0100 pta, - TP0094 cysS, - TP0091 TP0095 rpoE, - TP0092 rpoE, - TP0092 TP0093
* Calculated from Protein Sequence

Gene ID: TP0094

DNA Molecule Name:
1  

Genbank ID:
3322356

Gene Name:
pta  

Definition:
phosphotransacetylase

Gene Start:
102879

Gene Stop:
103886

Gene Length:
1008

Molecular Weight*:
36525

pI*:
7.25

Net Charge*:
0.79

EC:
2.3.1.8  

Functional Class:
Central intermediary metabolism  
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Carbohydrate metabolism; Pyruvate metabolism

Comment:
Reaction:
ACETYL-COA + ORTHOPHOSPHATE = COA + ACETYL-PHOSPHATE.

Blast Summary:  PSI-Blast Search
There are many significant hits to phosphotransacetylase proteins in
the database. For example residues 1-334 are 45% similar to
phosphotransacetylase of Clostridium acetobutylicum, (accesssion# U38234).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0280
COG name: Phosphotransacetylase
Functional Class:  C
The phylogenetic pattern of COG0280 is ------VcEBrH-jgpol--X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 105-238 are 47% similar to PHOSPHATE ACETYLTRANSFERASE of
EUTI_SALTY. Residues 4-72, 245-301 and 304-332 all represent
significant hits to PHOSPHATE ACETYLTRANSFERASE of PTA_METTE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 330 (E-value = 5.4e-134) place TP0094 in the PTA_PTB family which is described as Phosphate acetyl/butaryl transferase (PF01515)

PDB Hit:
none

Gene Protein Sequence:
MTFVESMQRRAVLAQKRLVLPEACEQRTLEAARLIVFRNIAAKVFLVGCE
RDIKNTADRCGIDLTDMVVIDPSVSKHRDQFAERYFQKRKHKGISLAQAA
EDMRDPLRFAAMMLDQGHADAMVAGAENTTARVLRAGLTIIGTLPSVKTA
SSCFVMDTNNPRLGGTRGLFIFSDCAVIPTPTAEQLADIACSAAESCRTF
IGEEPTVALLSYSTKGSGGDSDENILRVREAVRILHERRVDFTFDGELQL
DAALVPKITEKKAPHSPITGKVNTLVFPDLSSGNIGYKLVQRLSDADAYG
PFLQGFAKPLSDLSRGCSVEDIVAACAVTLVQSNGR

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCTTCGTTGAATCAATGCAGCGGCGTGCTGTGCTTGCGCAAAAACG
ACTCGTGCTTCCTGAGGCCTGCGAGCAGCGTACGCTCGAAGCCGCCCGTT
TGATTGTGTTCAGAAACATAGCCGCAAAAGTTTTTCTTGTCGGATGCGAG
CGTGATATCAAAAACACCGCAGACAGGTGCGGTATCGACCTTACCGACAT
GGTCGTCATCGATCCGAGCGTTAGCAAGCACAGAGATCAGTTCGCAGAAC
GTTATTTTCAGAAGCGAAAACACAAAGGAATAAGTCTTGCCCAGGCTGCA
GAGGATATGCGCGATCCTCTGCGTTTCGCTGCTATGATGCTTGACCAAGG
TCACGCAGATGCCATGGTTGCCGGTGCAGAAAACACTACCGCGCGCGTTC
TTCGTGCAGGCCTCACCATCATCGGAACCCTTCCGAGTGTTAAAACTGCC
TCTTCCTGCTTCGTTATGGATACTAATAACCCCCGTCTGGGAGGAACACG
TGGTCTATTTATTTTTTCAGACTGTGCAGTGATCCCCACTCCCACCGCAG
AACAGTTGGCTGATATCGCCTGCTCTGCTGCAGAAAGCTGCCGCACCTTC
ATTGGAGAGGAACCGACTGTCGCACTTCTTTCCTACTCTACTAAAGGATC
AGGAGGTGATAGTGACGAGAATATCCTGCGTGTACGTGAGGCAGTCAGGA
TTCTACACGAACGGCGGGTGGACTTTACCTTCGATGGGGAATTGCAGCTC
GATGCTGCGCTCGTACCTAAGATTACCGAAAAAAAAGCGCCTCACAGTCC
TATTACGGGAAAGGTGAACACACTCGTGTTTCCCGATCTTTCTTCGGGTA
ATATTGGGTACAAGCTTGTCCAGCGCCTTTCAGATGCGGATGCATACGGA
CCTTTCCTGCAAGGTTTTGCAAAACCACTGTCTGATCTCTCGCGTGGGTG
CTCGGTTGAAGATATCGTCGCCGCTTGTGCAGTCACACTTGTGCAATCGA
ATGGACGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy