Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR73 IGR67 IGR68 IGR71 IGR69 IGR72 IGR70 TP0088 murB, - TP0090 TP0089 TP0093 TP0086 pta, - TP0094 cysS, - TP0091 TP0095 TP0088 murB, - TP0090 TP0089 TP0093 TP0086 pta, - TP0094 cysS, - TP0091 TP0095 Type: tandem, Name:  - 229 Type: tandem, Name:  - 24 Type: tandem, Name:  - 227 Type: tandem, Name:  - 228 murB, - TP0090 TP0089 TP0087 TP0088 TP0087 TP0086 pta, - TP0094 cysS, - TP0091 TP0095 rpoE, - TP0092 rpoE, - TP0092 TP0093
* Calculated from Protein Sequence

Gene ID: TP0091

DNA Molecule Name:
1  

Genbank ID:
3322350

Gene Name:
cysS  

Definition:
cysteinyl-tRNA synthetase

Gene Start:
99989

Gene Stop:
101548

Gene Length:
1560

Molecular Weight*:
58393

pI*:
7.97

Net Charge*:
8.04

EC:
6.1.1.16  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
This enzyme uses ATP to charge tRNA(cys) with cysteine to form
cysteinyl-tRNA.

Blast Summary:  PSI-Blast Search
There are many significant hits to cysteinyl-tRNA synthetase proteins
in the database. For example residues 1-519 are 33% similar to SYC_BACSU
cysteinyl-tRNA synthetase of Bacillus subtilis, (accession# Z99104).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0215
COG name: Cysteinyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0215 is a--kyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Significant (95%) but unlikely hit to blocks (PR00511), TEKTIN SIGNATURE.
Residues 128-144 and 496-512 correspond to blocks.

ProDom Summary:  Protein Domain Search
Residues 38-155 are 37% similar to CYSTEINYL-TRNA SYNTHETASE of
SYC_ECOLI. Residues 190-236 and 394-519 are also significantly
similar to CYSTEINYL-TRNA SYNTHETASES.

Paralogs:  Local Blast Search
This protein is weakly paralogous to TP0091, methionyl-tRNA
synthetase. Residues 31-105 are 32% similar to TP0091.

Pfam Summary:  Pfam Search
Residues 15 to 350 (E-value = 4.8e-85) place TP0091 in the tRNA-synt_1e family which is described as tRNA synthetases class I (C) catalytic domain (PF01406)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
282  
520

PDB Hit:
none

Gene Protein Sequence:
MALRVYNTLTRQQEHFQPWEHGHVRLYGCGPTVYNYPHLGNLRAYVFQDT
VRRTLHFLGYRVTYVMNITDVGHLESDADSGEDKLVRSAQAHGHSVLQVA
AHYRAAFFRDTALLGIEEPSIVCNASDCIQDMIAFIEQLLARGHAYCAGG
NVYFDVRSFPSYESFGSAAVEDVQEGEDAARARVAHDTHKRDARDFVLWF
TRSKFVRHALTWDSPWGRGYPGWHIGCSAMSMKFLGPRCDIHIGGVDHIR
VHHRNERAQCEAITGAPWVRYWLHHEFLLMQLQKRAVHADMGSSVVSSFS
KMSKSCGQFLTLSSLQERGFQPADFRFFLLSGQYRTQLAFSWDALKTARA
ARRSFVRRVARVVDAARATTGSVRGTSAECAAERVCESRASESELLLTDF
RAALEDDFSTPRALSALQKLVRDTSVPPSLCVSALQVADTVLGLGIIQEA
TASLSAQVPAGDTLPQRPLPSEEWIGQLVRARAHARQTRDFPRADEIRRQ
LKAEGIELEDTHLGTIWKRV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCCTTGCGCGTATACAACACCCTTACTCGTCAGCAAGAGCACTTTCA
ACCCTGGGAGCACGGGCACGTGCGTCTCTACGGTTGTGGGCCTACGGTGT
ACAATTATCCCCATCTGGGGAATCTGCGCGCATACGTTTTTCAGGATACG
GTTCGACGTACCTTGCACTTTCTTGGATACCGCGTCACCTACGTTATGAA
TATTACCGACGTTGGGCATTTAGAAAGTGACGCAGACAGTGGTGAGGATA
AGCTGGTAAGGAGCGCACAGGCGCATGGCCACTCGGTGTTGCAGGTTGCA
GCGCACTATCGCGCAGCCTTTTTCCGCGATACTGCACTGCTCGGTATTGA
AGAGCCGTCCATTGTCTGTAATGCCAGCGATTGTATCCAGGATATGATCG
CGTTTATCGAGCAATTGCTCGCGCGTGGGCACGCGTACTGTGCAGGAGGG
AACGTGTATTTTGATGTGCGATCCTTTCCTAGCTACGAAAGCTTCGGTTC
TGCCGCGGTAGAAGATGTTCAGGAAGGAGAGGATGCGGCGCGCGCGCGGG
TGGCACACGATACGCATAAGCGTGATGCACGTGATTTTGTGCTGTGGTTT
ACCCGTAGTAAATTTGTGCGTCATGCGTTGACGTGGGATTCTCCGTGGGG
GCGGGGGTACCCCGGGTGGCACATCGGGTGTTCTGCAATGAGCATGAAGT
TTTTAGGACCACGTTGCGACATCCACATCGGAGGGGTGGATCATATTCGT
GTGCATCACCGTAACGAGCGTGCTCAGTGTGAAGCAATTACTGGTGCACC
CTGGGTGAGGTACTGGTTACACCACGAGTTCTTGCTGATGCAGCTGCAAA
AGCGCGCAGTACATGCGGATATGGGCAGTTCGGTGGTGTCGTCTTTTTCT
AAAATGTCCAAGTCCTGTGGGCAGTTTTTGACGCTTTCTTCGCTGCAGGA
GCGTGGCTTTCAGCCAGCTGATTTTCGCTTCTTTTTGTTGAGTGGACAGT
ATCGCACGCAACTTGCTTTTTCTTGGGATGCGCTAAAAACGGCGCGTGCC
GCCCGACGGAGTTTTGTGCGGCGAGTGGCGCGTGTAGTGGACGCTGCTCG
AGCAACTACAGGCAGCGTGCGCGGCACTAGTGCAGAGTGTGCCGCAGAAA
GGGTGTGTGAATCGCGCGCATCAGAATCTGAGCTGCTCTTAACTGACTTT
CGTGCTGCGTTGGAGGATGACTTTTCTACGCCACGTGCTCTGAGCGCCTT
ACAAAAATTGGTGCGTGATACCTCGGTGCCGCCATCGCTGTGTGTTTCGG
CACTCCAGGTGGCGGATACAGTGCTAGGGTTAGGCATAATACAGGAAGCG
ACCGCATCGCTATCTGCGCAGGTTCCTGCTGGCGATACGTTGCCGCAGCG
TCCTTTACCGAGTGAGGAGTGGATTGGACAGTTGGTGCGTGCGCGTGCAC
ATGCACGCCAAACGCGTGATTTTCCCCGTGCAGATGAGATCCGTCGGCAG
TTGAAGGCTGAAGGGATTGAACTTGAAGACACCCATCTTGGGACTATTTG
GAAGCGCGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy