Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR73 IGR67 IGR68 IGR71 IGR66 IGR69 IGR65 IGR72 IGR70 TP0084 ptsBC,ptsA, - TP0085 TP0088 murB, - TP0090 TP0089 TP0093 TP0086 pta, - TP0094 TP0083 cysS, - TP0091 TP0095 TP0084 ptsBC,ptsA, - TP0085 TP0088 murB, - TP0090 TP0089 TP0093 TP0086 pta, - TP0094 TP0083 cysS, - TP0091 TP0095 Type: tandem, Name:  - 228 Type: tandem, Name:  - 23 Type: tandem, Name:  - 24 Type: tandem, Name:  - 227 ptsBC,ptsA, - TP0085 murB, - TP0090 TP0089 TP0087 TP0088 TP0084 TP0087 TP0093 TP0086 pta, - TP0094 TP0083 cysS, - TP0091 TP0095 rpoE, - TP0092 rpoE, - TP0092
* Calculated from Protein Sequence

Gene ID: TP0090

DNA Molecule Name:
1  

Genbank ID:
3322351

Gene Name:
murB  

Definition:
UDP-N-acetylpyruvoylglucosamine reductase

Gene Start:
99807

Gene Stop:
98746

Gene Length:
1062

Molecular Weight*:
38582

pI*:
11.54

Net Charge*:
26.70

EC:
1.1.1.158  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Nucleotide metabolism; Aminosugars metabolism

Comment:
The MurB protein is involved in cell wall biosynthesis.

Reaction: UDP-N-ACETYLMURAMATE + NADP(+) =
UDP-N-ACETYL-3-O-(1-CARBOXYVINYL)-D-GLUCOSAMINE + NADPH.

There is a 3D structure of the E. coli protein.

Blast Summary:  PSI-Blast Search
After PSI-BLAST converges there are many significant hits to
UDP-N-acetylpyruvoylglucosamine reductase proteins in the database.
For example residues 16-349 are 20% similar to MURB_SALTY.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0812
COG name: UDP-N-acetylmuramate dehydrogenase
Functional Class:  M
The phylogenetic pattern of COG0812 is -----Qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 106-126 and 25-41 represent significant (99%) hits to blocks
(PR00738), GLYCOSYL HYDROLASE FAMILY 20 SIGNATURE. Residues 179-191
represent a significant (96%) but unlikely hit to blocks (BL00021),
Kringle domain proteins.

ProDom Summary:  Protein Domain Search
Residues 227-312 are 34% similar to UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE
of MURB_BACSU. Residues 119-155 also represent a significant match to
UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE of MURB_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 30 to 187 (E-value = 6.2e-18) place TP0090 in the FAD_binding_4 family which is described as FAD binding domain (PF01565)
Residues 238 to 342 (E-value = 1.2e-59) place TP0090 in the MurB_C family which is described as UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain (PF02873)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
21
transmembrane  
100  
117

PDB Hit:
gi|2098437|pdb|1UXY| Murb Mutant With Ser 229 Replaced By Ala, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Peptidoglycan Synthesis, Cell Wall, Cell Division, Oxidoreductase, Nadp, Flavoprotein, Fad Mol_id: 1; Molecule: Uridine Diphospho-N-Acetyle...

Gene Protein Sequence:
MSAHRIRARRITRRNVPLAERCSFRIGGAAQFWAEPRSCTQLRALIEEAQ
RARIPLSLIGGGSNVLIADEGVPGLMLSLRRFRSLHTQTQRDGSVLVHAG
AGLPVAALLAFCAHHALRGLETFAGLPGSVGGAAYMNARCYGRAIADCFH
SARTLVLHPVRSRAKELPEVRKNAQDKRGECLGLDGGPFTCSSFQTVFAR
AGDWGYKRSPFQSPHGVELHAGRRLILSLCVRLTPGNPAQIRKHMQEKIA
DRISKGQFRFPSAGSAFKNNPAFGKPSGILIEEAGLRGTSCGAAQVAPWH
GNLIINTGNATAHQVRTLLRVVRQRVFETHGVWLEREIIFSGESVRMTSS
SRDS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGCGCACCGGATACGCGCGCGTCGGATCACGCGCCGTAACGTCCC
ACTTGCAGAGCGATGTTCTTTCCGCATTGGTGGCGCTGCGCAGTTTTGGG
CGGAGCCGCGCTCCTGCACACAGCTGCGCGCGCTTATTGAGGAAGCGCAG
CGCGCACGCATTCCGCTGTCCCTTATTGGGGGAGGCTCTAACGTGTTAAT
CGCAGACGAGGGCGTACCGGGTCTGATGTTGAGCCTTCGTCGCTTTCGCA
GTCTACACACCCAAACACAGCGCGATGGCTCAGTGCTCGTACATGCAGGC
GCGGGGTTACCTGTGGCCGCCCTCCTGGCCTTTTGTGCCCATCACGCTCT
ACGCGGGCTTGAGACCTTTGCAGGGCTGCCTGGTAGTGTCGGTGGTGCCG
CGTACATGAACGCCCGATGTTATGGGCGTGCAATCGCAGATTGCTTTCAC
TCTGCGCGCACGCTCGTACTTCACCCCGTGCGTTCGCGCGCAAAAGAACT
GCCAGAGGTGAGAAAAAACGCACAAGACAAAAGAGGGGAATGTCTTGGCC
TCGACGGCGGACCGTTTACCTGCAGCAGTTTTCAGACCGTCTTCGCGCGC
GCGGGGGATTGGGGCTACAAGCGCTCTCCTTTCCAGAGTCCTCACGGTGT
TGAACTCCATGCAGGAAGGCGTCTTATCCTCTCGCTGTGTGTACGTCTCA
CTCCCGGCAATCCGGCGCAGATTAGGAAGCACATGCAGGAGAAGATTGCC
GATCGTATTTCAAAGGGGCAGTTTCGCTTTCCGTCAGCAGGCAGCGCGTT
TAAAAACAACCCAGCTTTTGGTAAACCGTCTGGCATTCTCATAGAAGAGG
CAGGTTTACGGGGCACCTCCTGTGGGGCTGCGCAGGTAGCACCCTGGCAT
GGAAATCTCATTATCAATACGGGGAATGCCACCGCACATCAGGTGCGCAC
ACTCTTGCGCGTCGTTCGGCAACGCGTGTTTGAAACACACGGAGTGTGGC
TCGAACGGGAAATCATTTTTTCTGGAGAATCTGTGAGGATGACTTCCAGT
TCGCGAGACTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy