Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR67 IGR68 IGR63 IGR66 IGR69 IGR65 IGR70 IGR64 TP0084 ptsBC,ptsA, - TP0085 TP0088 murB, - TP0090 TP0089 TP0082 TP0081 TP0086 TP0083 cysS, - TP0091 TP0084 ptsBC,ptsA, - TP0085 TP0088 murB, - TP0090 TP0089 TP0082 TP0081 TP0086 TP0083 cysS, - TP0091 Type: tandem, Name:  - 23 Type: tandem, Name:  - 227 ptsBC,ptsA, - TP0085 murB, - TP0090 TP0089 TP0082 TP0087 TP0088 TP0084 TP0087 TP0081 TP0086 TP0083 cysS, - TP0091
* Calculated from Protein Sequence

Gene ID: TP0085

DNA Molecule Name:
1  

Genbank ID:
3322345

Gene Name:
ptsBC  ptsA  

Definition:
PTS system nitrogen regulatory IIA component/ PTS system nitrogen regulatory BC component

Gene Start:
95230

Gene Stop:
94787

Gene Length:
444

Molecular Weight*:
16295

pI*:
5.38

Net Charge*:
-4.13

EC:
2.7.1.69  

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism
Carbohydrate metabolism; Galactose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Membrane transport; Phosphotransferase system
Metabolism of complex carbohydrates; Starch and sucrose metabolism
Nucleotide metabolism; Aminosugars metabolism

Comment:
This protein is similar to a component of the phosphoenolpyruvate-
dependent sugar phosphotransferase system (PTS), a major carbohydrate
active-transport system. The IICD domains contain the sugar binding
site and the transmembrane channel; the IIA domain (TP0755) contains
the primary phosphorylation site (the donor is phospho-HPR); IIA
transfers its phosphoryl group to the IIB domain which finally
transfers it to the sugar.

Reaction: PROTEIN N-PHOSPHOHISTIDINE + SUGAR =
PROTEIN HISTIDINE + SUGAR PHOSPHATE.

Blast Summary:  PSI-Blast Search
There were many significant hits to the phosphotransferase system
(PTS) proteins with the most common being to nitrogen regulatory
IIA protein. However, the strongest hit after PSI-BLAST converged
was to the phosphotransferase system (PTS) fructose-specific enzyme
IIBC component of Bacillus subtilis (Z99111). Residues 1-148 were 33%
similar to the IIBC subunit of B. subtilis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1762
COG name: Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)
Functional Class:  G,T
The phylogenetic pattern of COG1762 is --------EB-H--gPOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 38-146 are 25% similar to PHOSPHOTRANSFERASE ENZYME II of
PTFB_MYCGE. Residues 46-110 are 36% similar to PHOSPHOTRANSFERASE
ENZYME II of PTSN_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0755, PTS system, nitrogen
regulatory IIA component. Residues 3-148 are 23% similar to TP0755.

Pfam Summary:  Pfam Search
Residues 5 to 148 (E-value = 1.1e-08) place TP0085 in the PTS_EIIA_2 family which is described as Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359)

PDB Hit:
none

Gene Protein Sequence:
MNLETVLTPETVSLHLKGSTKEEIIDEMLEMFVRAGRVSDKVAARECVLD
RERKMSTGMKHGIAIPHGKTNSVSSLVAGVGVSDSPVDFDSLDQEPCRIF
IMTLSPLDVTGPHLQFLAEISLLFKSSEKRREILDATSKAEVIKILTE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTGGAGACCGTGTTGACGCCGGAAACCGTAAGCCTGCACCTGAA
GGGTTCTACCAAGGAGGAGATCATCGACGAAATGCTCGAGATGTTCGTCC
GTGCAGGAAGGGTGAGCGACAAGGTTGCTGCGCGGGAGTGTGTGCTCGAT
CGAGAGCGAAAAATGTCTACGGGGATGAAGCATGGCATTGCCATACCCCA
CGGTAAAACTAATTCAGTGAGTAGTCTGGTTGCAGGGGTTGGTGTTTCTG
ACAGTCCGGTTGACTTCGACTCTTTGGATCAAGAACCTTGTCGTATTTTC
ATAATGACCCTTTCTCCACTTGACGTCACTGGTCCGCACCTGCAGTTCTT
GGCTGAGATCAGTCTCCTGTTTAAGAGTTCTGAGAAACGTCGGGAGATCC
TTGATGCAACAAGTAAAGCGGAGGTTATTAAAATCCTCACCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy