Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR61 IGR62 IGR63 IGR65 IGR64 TP0084 ptsBC,ptsA, - TP0085 TP0082 TP0080 TP0081 TP0083 cap, - TP0077 xdh, - TP0079 TP0084 ptsBC,ptsA, - TP0085 TP0082 TP0080 TP0081 TP0083 cap, - TP0077 xdh, - TP0079 Type: tandem, Name:  - 22 Type: tandem, Name:  - 23 ptsBC,ptsA, - TP0085 TP0082 TP0084 TP0080 TP0081 TP0083 cap, - TP0077 xdh, - TP0079 TP0078 TP0078
* Calculated from Protein Sequence

Gene ID: TP0081

DNA Molecule Name:
1  

Genbank ID:
3322340

Gene Name:


Definition:
conserved hypothetical protein/ possible XDH-related protein

Gene Start:
89734

Gene Stop:
90579

Gene Length:
846

Molecular Weight*:
31597

pI*:
10.44

Net Charge*:
11.98

EC:
1.1.1.204  

Functional Class:
Conserved hypothetical  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
TP0081 is to BB0556 as TP0080 is to BB0555, with both Treponema orfs
showing weak similarity to xanthine dehydrogenase sequences. See also
TP0079.

See TP0079, xdh-related protein I.
See TP0080, xdh-related protein III.

Blast Summary:  PSI-Blast Search
The best match using gapped BLAST is to a hypothetical protein from B.
burgdorferi,(AE001157, coding region BB0556). Residues 57-245 are 24%
similar to the Borrelia protein. There are several subthreshold hits
to xanthine dehydrogenase in the nr database using gapped BLAST.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1319
COG name: FeS-containing oxidoreductases, xanthine dehydrogenase homologs
Functional Class:  R
The phylogenetic pattern of COG1319 is --------Ebr-----ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 9 to 178 (E-value = 3.7e-09) place TP0081 in the FAD_binding_5 family which is described as FAD binding domain in molybdopterin dehydrogenase (PF00941)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
135

PDB Hit:
none

Gene Protein Sequence:
MHLYKNSESSVIYYVKSLGQLCAVLRNVAQVQPVGGGTGLVQYQITPVLT
LPSHLVVLNGVPELKDISKTEHFLEFGGAVSLQAIVRLGRKNIPVALHEA
LSHAANPGIRTLATIGGNIAGTRPHASALAPLIALDAKMEVRTGHENFWI
SVAHYAHARSDTLRHRSHVITRIRLPTDYWDFSYYRRIGSRALFGERADF
VFLAQQQKNALSEMRMVFFSDVVMRNREFDNLLLGRAIPLSAGDIAAIVY
RSREFFAPESFKSAYIAHCFFHLLEDCLRRLR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCTGTATAAGAACTCAGAATCAAGTGTTATTTATTACGTAAAAAG
TTTGGGTCAATTGTGTGCGGTACTACGTAACGTCGCGCAGGTACAGCCAG
TTGGGGGTGGAACGGGCTTGGTGCAATATCAGATAACCCCGGTTTTAACG
TTGCCTTCACATTTGGTTGTTCTAAACGGTGTACCAGAGTTGAAAGATAT
TTCTAAAACTGAGCACTTTCTTGAGTTTGGTGGTGCTGTGTCGTTGCAAG
CAATTGTGCGATTGGGAAGAAAAAATATTCCCGTGGCACTGCACGAGGCA
CTGTCGCACGCAGCAAATCCTGGGATACGGACTCTGGCCACTATTGGGGG
GAATATTGCAGGTACGCGTCCGCATGCTTCTGCTCTTGCGCCGCTTATCG
CGCTTGATGCAAAAATGGAGGTGCGGACTGGACATGAAAACTTTTGGATT
TCTGTGGCACACTATGCACATGCGCGTTCTGACACGCTGCGACACCGGAG
TCATGTAATTACCCGTATTCGCCTTCCAACAGATTACTGGGACTTTTCCT
ACTACAGACGTATTGGGTCGCGTGCATTATTTGGTGAACGTGCCGATTTC
GTGTTTCTTGCACAGCAGCAGAAAAACGCGTTGTCTGAAATGCGTATGGT
ATTTTTTTCAGATGTAGTAATGAGAAATAGAGAATTTGACAATTTGCTGT
TAGGCAGAGCGATTCCTCTTTCTGCAGGGGATATTGCGGCAATCGTATAT
CGAAGCAGAGAGTTCTTTGCGCCTGAATCCTTTAAGAGTGCGTACATCGC
GCACTGCTTCTTTCATCTGCTGGAAGACTGTTTGCGCCGCTTAAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy