Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR54 IGR53 IGR56 IGR52 IGR55 IGR57 TP0069 TP0073 clpB, - TP0071 TP0072 TP0065 TP0068 TP0067 malE, - TP0074 TP0069 TP0073 clpB, - TP0071 TP0072 TP0065 TP0068 TP0067 malE, - TP0074 Type: tandem, Name:  - 20 Type: tandem, Name:  - 21 TP0073 clpB, - TP0071 TP0070 TP0069 TP0070 TP0072 TP0068 TP0067 malE, - TP0074 TP0066 TP0065 TP0066
* Calculated from Protein Sequence

Gene ID: TP0071

DNA Molecule Name:
1  

Genbank ID:
3322325

Gene Name:
clpB  

Definition:
ATP-dependent Clp protease subunit B

Gene Start:
78542

Gene Stop:
75909

Gene Length:
2634

Molecular Weight*:
98977

pI*:
6.31

Net Charge*:
-6.76

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Typically this protein is induced by heat-shock, (sigma 32) and thought
to be an ATPase subunit of an intracellular ATP-dependent protease.

See TP0549 (clpC), TP0801 (clpA), TP0508 (clpX), TP0507 (clpP),
TP1041 (clpP).

Blast Summary:  PSI-Blast Search
There were many significant hits to clp proteases. For example residues
2-874 were 54% similar to CLPB_SYNY3 ATP-dependent Clp proteinase
regulatory chain B of Synechocystis sp., (accession# D90914).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0542
COG name: ATPases with chaperone activity, ATP-binding domain
Functional Class:  O
The phylogenetic pattern of COG0542 is --t-YQVCEBRhUJgpOLINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Significant (100%) hit to blocks (BL00870), which is undefined portion
of the clpB protein. Residues 175-220, 578-623, 227-266, 273-287,
291-333, 361-403, 570-618, 633-681, 696-724, 767-781, 251-265, and
825-837 correspond to blocks.
Additionally there were significant (98%) hit to blocks (PR00499),
TRANSFORMING PROTEIN P21 RAS SIGNATURE. Residues 200-221, 603-624
and 129-151 correspond to blocks. Finally there was significant (97%)
but unlikely (because of low complexity) hit to blocks (PR00364),
DISEASE RESISTANCE PROTEIN SIGNATURE. Residues 604-619 and 201-216
correspond to blocks.

ProDom Summary:  Protein Domain Search
Residues 161-406 are 80% similar to a CLPB domain observed in
CLPB_CORGL. Residues 2-55, 407-574, 452-762, 461-574, 470-574,
473-574, 508-574, 660-702, 703-727, and 757-859 also show significant
similarity to CLPB domains seen in CLPB_SYNY3, CLPB_ECOLI, and other
bacterial CLPB proteins. Residues 407-574 are also similar to heat
shock protein domains of H101_ARATH, HSP7_YEAST, et al. Residues
519-574 have similarity to a domain in negative regulatory elements,
as exemplified by MECB_BACSU.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0549 (clpC), TP0801 (clpA),
TP0508 (clpX). Residues 29-865 are 40% similar to TP0549 (clpC).
Residues 29-428 are 40% similar and residues 523-862 are 41% similar to
TP0801 (clpA). Residues 536-847 are 22% similar and residues 199-280
are 29% similar to TP0508 (clpX).

Pfam Summary:  Pfam Search
Residues 17 to 69 (E-value = 1.7e-11) place TP0071 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 94 to 145 (E-value = 1.1e-14) place TP0071 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 201 to 395 (E-value = 3.9e-15) place TP0071 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
167  
296
coil-coil  
394  
488

PDB Hit:
none

Gene Protein Sequence:
MNTDRYTVKASEALNDAISLAEAENHGQVEEEHLLHALLSQKDGIISPLI
EKIGAKPDFLYDELLQCLRRKPRVTGPAAQTRCAPTLSKACARAERLALK
NQDEYVSCEHLLLAISETDSNTARLLHSQGITSKTISAALKDIRGSKRVT
SQDPESTFQCLEKYCRDLTTLAREEKIDPVIGRDEEIRRVMQVLSRRTKN
NPVLIGEPGVGKTAIVEGLARRIVSGDVPESLKGKRLLSLDLGALVAGAK
FRGEFEERLKAVIEAVQKSDGGVILFIDELHTLVGAGASEGSMDASNLLK
PALARGELRSIGATTLNEYRKYIEKDAALERRFQQVYCVQPTVEDTIAIL
RGLQEKYEVHHGVRIKDEALVAATVLSDRYITNRFLPDKAIDLVDEAASR
LKMEIESQPVELDQVERKILQLNIEKASLLKESDPASKERLEKLEKELAG
FLERRAAMQVQWQNEKGRIEESRRYKEELERLRIEETMFSREGDLNKAAE
LRYGKIPELEKKIMLLTAEVEKKSGLEGQLLREEVCEEDIAKIISMWTGI
PVSKMMASEQQKYLQLESVLMQRVVGQDEAVRVISDAIRRNKAGLSDTRR
PLGSFLCVGPTGVGKTELARTLADFLFNDERALTRIDMSEYMEKHAISRL
IGAPPGYVGYDEGGQLTEAVRRRPYSVLLFDEVEKAHQDVFNIFLQILDD
GRLTDGQGRVVDFRNTIIIMTSNIGSEHILSARESRTHTSDLPVPETQST
EEQTLPEQIRGLLHTYFRPEFLNRIDEVLIFKRLTRKHIRLITDIQLQMV
VERLESRHIKLRVRDAAKAYLAERGYDDTFGARPLKRAIQTELENALARE
ILSGRFRGGSTIVVDMCKDALCFTEQTS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACAGACAGGTACACAGTCAAAGCAAGCGAAGCGCTCAATGACGC
CATATCTCTGGCAGAAGCGGAGAACCACGGTCAAGTTGAGGAGGAACATC
TACTCCACGCCCTACTTTCCCAGAAAGACGGGATTATCTCTCCGCTCATT
GAAAAAATTGGGGCAAAACCGGACTTCCTGTACGATGAATTACTCCAATG
CCTGCGCCGCAAACCACGTGTTACCGGTCCTGCCGCCCAAACGCGCTGTG
CACCAACGCTGAGCAAAGCCTGTGCACGTGCAGAACGCCTCGCGCTCAAG
AACCAAGATGAATATGTCTCCTGCGAACATCTCCTGCTTGCCATAAGTGA
GACAGATAGCAACACTGCACGTCTCCTTCACAGTCAGGGCATTACCAGTA
AAACTATCAGTGCCGCCCTCAAAGATATACGCGGCAGCAAGCGCGTTACG
AGCCAGGATCCAGAATCAACATTCCAGTGCTTGGAGAAATACTGCCGAGA
TCTTACTACCCTCGCCCGAGAAGAAAAAATAGATCCGGTTATTGGACGTG
ATGAAGAGATCCGGCGCGTTATGCAGGTACTCTCACGTCGTACAAAAAAT
AACCCAGTGCTTATTGGAGAACCCGGCGTAGGGAAAACCGCTATTGTCGA
GGGACTTGCACGCCGTATCGTTTCAGGAGACGTACCAGAAAGCCTCAAGG
GAAAGCGTTTGCTTTCCCTTGACCTCGGCGCATTGGTTGCCGGTGCAAAG
TTCCGCGGGGAATTTGAAGAACGACTAAAAGCGGTAATTGAAGCGGTACA
GAAAAGCGACGGTGGCGTTATTTTATTCATTGATGAACTACACACGCTCG
TAGGCGCCGGCGCAAGTGAGGGATCTATGGATGCGTCGAACCTTCTGAAA
CCTGCGCTTGCGCGCGGTGAATTGCGTTCAATCGGCGCAACCACGCTCAA
CGAATATCGCAAATATATCGAAAAGGACGCAGCGCTCGAACGCCGCTTTC
AGCAAGTGTACTGCGTACAGCCTACGGTGGAGGACACCATTGCTATCCTG
CGCGGTTTGCAAGAAAAGTACGAAGTGCATCACGGGGTACGTATCAAAGA
TGAAGCGCTTGTTGCAGCAACCGTTTTGTCTGACCGTTACATCACCAACC
GCTTTTTACCAGATAAGGCGATTGATCTGGTGGATGAAGCAGCAAGCCGC
CTGAAAATGGAAATTGAAAGTCAGCCTGTTGAGCTAGACCAGGTGGAGCG
CAAGATATTACAGCTGAATATCGAAAAGGCCTCTCTCCTTAAAGAAAGTG
ATCCGGCTTCAAAGGAACGTTTGGAAAAGTTAGAAAAAGAGCTCGCAGGC
TTCCTAGAGCGCCGTGCTGCAATGCAGGTCCAATGGCAAAATGAGAAAGG
GAGGATAGAAGAGTCACGCCGCTACAAAGAGGAGCTTGAGCGTCTCCGCA
TTGAGGAAACCATGTTTTCACGTGAAGGGGACCTGAACAAGGCTGCAGAA
CTTCGGTATGGCAAAATTCCAGAACTTGAAAAAAAAATCATGCTTCTTAC
TGCAGAAGTAGAGAAAAAATCCGGTCTAGAAGGACAGCTCTTGCGCGAGG
AAGTGTGTGAAGAGGACATTGCGAAAATTATTTCTATGTGGACCGGAATT
CCGGTATCCAAAATGATGGCAAGCGAGCAACAGAAATATCTGCAGCTTGA
GTCAGTACTCATGCAACGTGTGGTAGGGCAGGACGAAGCAGTGCGGGTAA
TTTCCGACGCGATTCGTCGTAATAAGGCAGGACTTTCTGATACGCGCCGT
CCTCTTGGCAGTTTCTTATGTGTCGGTCCCACGGGGGTAGGAAAGACAGA
ACTTGCACGTACGTTAGCTGATTTTCTTTTCAACGATGAGCGTGCACTGA
CGCGTATCGATATGAGTGAATACATGGAAAAACACGCGATCAGCCGACTC
ATTGGCGCGCCCCCGGGGTATGTGGGCTATGACGAGGGGGGACAATTGAC
AGAAGCGGTACGACGTAGACCCTACAGCGTACTTCTTTTTGATGAAGTAG
AGAAAGCGCACCAGGATGTGTTTAATATATTCCTGCAAATACTCGACGAT
GGGCGCTTGACTGACGGCCAAGGAAGGGTGGTGGATTTCCGCAACACGAT
CATCATCATGACCAGCAATATCGGATCAGAGCATATTCTTTCTGCACGCG
AGTCGCGCACACACACGTCGGACTTGCCTGTACCCGAGACACAATCTACA
GAAGAACAAACTCTACCAGAGCAGATACGGGGATTACTGCACACATACTT
TCGCCCAGAATTCTTAAACCGGATTGACGAAGTGTTAATTTTTAAGCGTC
TCACACGGAAACATATTCGCCTCATCACAGACATCCAACTGCAGATGGTA
GTGGAGCGTTTGGAAAGTCGACATATAAAACTTCGTGTGCGTGACGCGGC
GAAAGCCTATCTTGCGGAGCGCGGATACGACGACACTTTCGGAGCACGAC
CACTGAAGCGTGCAATCCAAACGGAATTGGAAAATGCCCTAGCGCGTGAG
ATTCTCAGTGGCCGATTCAGAGGCGGCTCAACTATCGTGGTGGATATGTG
TAAAGATGCTCTGTGTTTCACTGAACAAACATCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy