Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR46 IGR49 IGR44 IGR51 IGR45 IGR47 IGR48 IGR50 IGR43 rpsF, - TP0063 rpsR, - TP0061 rplI, - TP0060 ssb, - TP0062 dnaC,dnaB, - TP0058 TP0055 TP0064 TP0065 TP0054 TP0067 oadB, - TP0057 oadA, - TP0056 rpsF, - TP0063 rpsR, - TP0061 rplI, - TP0060 ssb, - TP0062 dnaC,dnaB, - TP0058 TP0055 TP0064 TP0065 TP0054 TP0067 oadB, - TP0057 oadA, - TP0056 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 Type: tandem, Name:  - 20 rpsF, - TP0063 rpsR, - TP0061 rplI, - TP0060 ssb, - TP0062 dnaC,dnaB, - TP0058 TP0059 TP0059 TP0055 TP0064 TP0054 TP0067 oadB, - TP0057 oadA, - TP0056 TP0066 TP0065 TP0066
* Calculated from Protein Sequence

Gene ID: TP0058

DNA Molecule Name:
1  

Genbank ID:
3322317

Gene Name:
dnaC  dnaB  

Definition:
replicative DNA helicase

Gene Start:
68956

Gene Stop:
67643

Gene Length:
1314

Molecular Weight*:
47785

pI*:
5.42

Net Charge*:
-5.20

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Folate biosynthesis
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Soultanas P, Wigley DB.
Site-directed mutagenesis reveals roles for conserved amino acid residues in the hexameric DNA helicase DnaB from Bacillus stearothermophilus.
Nucleic Acids Res. 2002 Sep;30(18):4051-60.
PMID: 12235389

Carr KM, Kaguni JM.
Escherichia coli DnaA protein loads a single DnaB helicase at a DnaA box hairpin.
J Biol Chem. 2002 Oct;277(42):39815-22.
PMID: 12161435

Soultanas P.
A functional interaction between the putative primosomal protein DnaI and the main replicative DNA helicase DnaB in Bacillus.
Nucleic Acids Res. 2002 Feb;30(4):966-74.
PMID: 11842108

Marsin S, McGovern S, Ehrlich SD, Bruand C, Polard P.
Early steps of Bacillus subtilis primosome assembly.
J Biol Chem. 2001 Dec;276(49):45818-25.
PMID: 11585815

Gautam A, Mulugu S, Alexander K, Bastia D.
A single domain of the replication termination protein of Bacillus subtilis is involved in arresting both DnaB helicase and RNA polymerase.
J Biol Chem. 2001 Jun;276(26):23471-9.
PMID: 11313334

Comment:
Participates in initiation and elongation during chromosome replication.


Blast Summary:  PSI-Blast Search
There are many significant hits to replicative DNA helicases. For
instance 8-435 are 38% similar to DNAC_BACSU, replicative DNA
helicase of Bacillus subtilis,(Z99124). Residues 5-435 are 36%
similar to DNAB_ECOLI, replicative DNA helicase of Escherichia coli,
(AE000478).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:? L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 35-136 are 35% similar to PROBABLE REPLICATIVE DNA HELICASE
of DNAC_BACSU. Residues 172-413 are 20% similar to DNA PRIMASE B
of PRIM_BPT3. Residues 192-373 are 41% similar to PROBABLE
REPLICATIVE DNA HELICASE of DNAC_BACSU. Residues 391-426 are 54%
similar to REPLICATIVE DNA HELICASE PROTEIN of DNAB_ODOSI.


Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 15 to 117 (E-value = 7.1e-47) place TP0058 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 188 to 382 (E-value = 1e-103) place TP0058 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

PDB Hit:
none

Gene Protein Sequence:
MPGMPNPTQELKGKIPPHNLEAERAVLGAVLLDDSALSTATEQLSASSFY
SAAHQRIFQALVELSDLGQRPDILVLSEHLRSCEALDFVGGSAYVASLTD
AVPSAANVEYYTRIVCDAAMRRSLLKVARIITAEAFNDTVSGNIVLETAQ
REIYDLTNARRVATFKLLKNLIPDLVNTIETRYRNQSDLVGIATGLTALD
NLTGGFQNSELIVIGARPSMGKTALAMTMASNIAIRQRIPTAFFSLEMSN
LLLMQRLIAAESGVSATNLRKGLLQLSDFGRIQNAAGEMYDAPLYIVDVP
NMKLLDLRAVARRLCVQEKIQIIFVDYLGLIVADNPFAPRYEQFAAISQS
LKSLARELDIPIVALSQVGRPAEGSAPNLADIRGSGAIEQDADVVMFLHR
DRNETETQLILAKQRNGPIGTVELEFQASFTRFVCKSP

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCGGGCATGCCTAATCCCACTCAGGAACTCAAGGGAAAAATTCCCCC
TCATAACCTAGAGGCCGAGCGGGCTGTGCTCGGCGCTGTTCTACTGGATG
ACTCTGCTCTGAGCACGGCAACAGAGCAGTTGTCTGCGAGCTCTTTTTAT
TCCGCTGCGCACCAGCGCATCTTTCAAGCACTCGTAGAGTTATCGGATTT
AGGTCAACGCCCTGATATCCTCGTGCTCAGCGAGCACCTGCGCTCCTGTG
AGGCGCTCGATTTCGTCGGTGGCAGCGCGTATGTTGCCTCTCTCACCGAT
GCGGTCCCAAGCGCCGCGAATGTTGAATACTACACACGCATCGTTTGCGA
CGCTGCCATGCGCCGGTCGCTACTAAAAGTAGCCCGCATTATCACCGCAG
AGGCATTCAATGACACCGTGTCGGGCAACATCGTACTCGAAACAGCACAA
AGGGAAATCTATGACCTAACAAATGCAAGGAGAGTAGCAACCTTCAAATT
GCTGAAAAACCTCATTCCTGATTTGGTCAATACTATTGAGACTCGTTACC
GAAATCAAAGCGATCTGGTCGGAATTGCCACCGGCCTAACGGCTCTGGAT
AATCTTACCGGTGGATTCCAGAACTCCGAGCTTATTGTCATAGGTGCGCG
TCCTTCCATGGGGAAAACTGCGCTCGCCATGACTATGGCCTCGAACATTG
CCATAAGGCAACGTATTCCAACCGCCTTTTTTTCTCTGGAAATGTCTAAT
TTGCTTCTGATGCAGCGACTTATCGCTGCAGAGTCAGGAGTATCCGCGAC
GAACCTGCGCAAAGGGCTTTTACAACTTTCCGATTTCGGGCGCATCCAAA
ACGCCGCAGGAGAGATGTACGACGCCCCACTTTACATCGTGGACGTGCCA
AACATGAAGCTACTGGATCTCCGTGCCGTGGCTCGTCGATTATGCGTACA
AGAAAAGATCCAGATTATTTTTGTCGACTACTTGGGACTTATCGTAGCAG
ACAATCCCTTTGCGCCCCGCTACGAACAATTTGCAGCGATCTCCCAATCA
CTAAAAAGCCTCGCGCGCGAGCTAGACATCCCCATCGTAGCACTTTCGCA
AGTCGGTCGACCGGCAGAGGGCTCTGCGCCAAACCTGGCGGACATTCGTG
GTTCGGGGGCAATTGAGCAGGACGCCGACGTGGTCATGTTTCTACACCGC
GACCGCAACGAAACCGAGACTCAACTCATTTTAGCGAAGCAACGCAACGG
CCCCATTGGGACAGTTGAGCTCGAATTCCAAGCGAGCTTTACCCGCTTCG
TCTGCAAAAGCCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy