Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR46 IGR49 IGR44 IGR51 IGR45 IGR47 IGR48 IGR50 IGR42 IGR43 rpsF, - TP0063 rpsR, - TP0061 rplI, - TP0060 ssb, - TP0062 nrdB, - TP0053 dnaC,dnaB, - TP0058 TP0055 TP0064 TP0065 TP0054 oadB, - TP0057 oadA, - TP0056 rpsF, - TP0063 rpsR, - TP0061 rplI, - TP0060 ssb, - TP0062 nrdB, - TP0053 dnaC,dnaB, - TP0058 TP0055 TP0064 TP0065 TP0054 oadB, - TP0057 oadA, - TP0056 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 rpsF, - TP0063 rpsR, - TP0061 rplI, - TP0060 ssb, - TP0062 nrdB, - TP0053 dnaC,dnaB, - TP0058 TP0059 TP0059 TP0055 TP0065 TP0054 oadB, - TP0057 oadA, - TP0056 TP0064
* Calculated from Protein Sequence

Gene ID: TP0057

DNA Molecule Name:
1  

Genbank ID:
3322314

Gene Name:
oadB  

Definition:
oxaloacetate decarboxylase beta subunit

Gene Start:
66156

Gene Stop:
67562

Gene Length:
1407

Molecular Weight*:
49471

pI*:
10.16

Net Charge*:
13.11

EC:
4.1.1.3  

Functional Class:
Amino acid biosynthesis; Arginine, Proline  
Energy metabolism; Fermentation  

Pathway: pathway table
Amino acid metabolism; Arginine and proline metabolism
Carbohydrate metabolism; Pyruvate metabolism

Comment:
See TP0056 for the likely alpha subunit (a gamma subunit has
not been identified).
The catalytic activity of Oad - OXALOACETATE = PYRUVATE + CO(2).

Blast Summary:  PSI-Blast Search
There are many hits in the database to decarboxylase proteins, with
the most common being the oxaloacetate decarboxylase beta subunit.
For example residues 128-449 are 47% similar to DCOB_SALTY, oxaloacetate
decarboxylase subunit beta of Salmonella typhimurium, (accession# M96434).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1883
COG name: Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit
Functional Class:  C
The phylogenetic pattern of COG1883 is a--k--v----------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Significant (97%) hit to blocks (PR00342), RHESUS BLOOD
GROUP PROTEIN SIGNATURE. Residues 203-220 and 380-398 correspond to
blocks.

ProDom Summary:  Protein Domain Search
Residues 128-153 were 68% similar to BETA CHAIN OF DECARBOXYLASE
OXALOACETATE of DCOB_SALTY. Residues 154-351 were 48% similar to
BETA CHAIN OF DECARBOXYLASE OXALOACETATE of DCOB_KLEPN. Residues
352-449 were 69% similar to BETA CHAIN OF DECARBOXYLASE OXALOACETATE
of DCOB_SALTY.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 89 to 468 (E-value = 7.2e-269) place TP0057 in the OAD_beta family which is described as Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit (PF03977)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
25
transmembrane  
112  
129
transmembrane  
135  
151
transmembrane  
173  
205
transmembrane  
209  
242
transmembrane  
247  
274
transmembrane  
303  
333
transmembrane  
376  
405
transmembrane  
447  
468

PDB Hit:
none

Gene Protein Sequence:
MNTRLPLRVLQCVLVGLLVCGPLCAATRRPVRASAPVPMVQSCKDTGARC
APASSMREDMRASHGAAPLLSVRKFLLNTWHSTGLYAFFHGVTQVPDLAN
PQRTHSVFGYQQALLLVVGLLIIYLGAAKGFEPLLLIPIGFGTVFVNIPG
AGMYSEHGMLKLIYDAGVGNEFFPMLIFMGIGALTDFGPLIANPKMAVLG
AAAQLGVFLTLFGVAALNFVPGIRYSILDACAIAIIGGADGPTSIYVSAK
LAPELMAVIAVAAYSYMALVPIIQPPLMRLLTTRKERLIRMKQLRPVSRI
ERVLFPLVLLLLSVLLIPAASPLIGMIAFGNFVKECGVVERLSKTMANEL
LNIVSILLSLGVGSQMTPDKIMNPNALGIIVLGLVAFSVATAGGVFMAKL
MNLFLSEKINPLIGSAGVSAVPMAARVSNKVGLEEDPSNFLLMHAMGPNV
AGVIGTAIAAGVFISAYGG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACGCGTTTACCCCTTCGAGTACTCCAGTGCGTGTTGGTGGGATT
GCTTGTGTGCGGGCCCCTGTGTGCAGCTACGCGCCGCCCGGTACGTGCTT
CTGCGCCGGTGCCTATGGTACAGAGTTGTAAAGACACGGGGGCACGATGT
GCGCCGGCGTCGTCCATGCGTGAGGACATGCGTGCGTCACACGGAGCTGC
GCCGCTTCTCTCTGTAAGGAAATTTTTACTCAATACGTGGCATAGTACCG
GTCTCTACGCTTTCTTTCATGGCGTAACACAGGTGCCGGATCTTGCAAAT
CCGCAGCGAACACACAGCGTGTTCGGTTATCAACAGGCGTTGCTGCTCGT
GGTTGGTCTGCTCATCATTTATCTCGGTGCTGCTAAGGGCTTTGAGCCGC
TGCTGCTCATTCCTATTGGCTTTGGTACTGTCTTCGTCAACATCCCTGGT
GCGGGCATGTATAGTGAGCATGGTATGCTCAAACTCATTTACGATGCTGG
GGTGGGGAATGAGTTTTTCCCTATGCTCATTTTTATGGGTATCGGTGCAC
TTACCGATTTTGGACCACTGATTGCGAATCCTAAAATGGCAGTCCTTGGT
GCCGCTGCCCAGTTAGGGGTGTTCCTTACTCTCTTTGGGGTTGCAGCGTT
GAACTTTGTACCCGGGATCCGCTACTCCATCCTGGATGCCTGCGCCATTG
CCATTATCGGTGGGGCGGACGGGCCAACTTCCATCTACGTATCTGCGAAG
CTTGCTCCCGAACTCATGGCCGTTATCGCGGTGGCGGCATATTCGTATAT
GGCTCTTGTACCTATTATTCAGCCTCCGCTTATGCGCCTGTTAACTACCA
GAAAAGAACGTCTTATTAGGATGAAACAGCTGCGTCCTGTTTCGCGGATA
GAGAGAGTACTCTTTCCGCTTGTCTTGCTCTTGCTCTCGGTGCTGCTCAT
TCCTGCGGCTTCCCCACTCATCGGTATGATCGCCTTCGGGAACTTTGTTA
AGGAATGCGGTGTTGTGGAGCGGTTGTCTAAGACGATGGCTAACGAGCTT
TTGAACATCGTGTCGATCTTGCTGTCTTTGGGTGTTGGTTCTCAGATGAC
ACCCGATAAGATTATGAACCCCAATGCCTTGGGCATTATCGTGTTGGGAC
TCGTTGCCTTTTCTGTCGCAACCGCAGGGGGAGTATTCATGGCAAAGTTA
ATGAATTTGTTTTTGAGCGAGAAAATTAATCCACTTATCGGTTCCGCAGG
GGTGAGTGCTGTTCCTATGGCCGCGCGTGTTTCTAATAAGGTGGGGCTAG
AGGAGGATCCTTCTAACTTCTTGCTTATGCACGCGATGGGTCCTAACGTG
GCTGGTGTCATTGGGACCGCGATAGCCGCAGGGGTGTTCATCTCGGCCTA
CGGAGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy