Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR44 IGR38 IGR41 IGR40 IGR42 IGR43 IGR39 TP0048 TP0050 TP0049 nrdB, - TP0053 TP0055 TP0054 prfA, - TP0051 oadB, - TP0057 oadA, - TP0056 TP0048 TP0050 TP0049 nrdB, - TP0053 TP0055 TP0054 prfA, - TP0051 oadB, - TP0057 oadA, - TP0056 Type: tandem, Name:  - 282 Type: tandem, Name:  - 17 Type: tandem, Name:  - 18 Type: tandem, Name:  - 226 TP0050 TP0049 nrdB, - TP0053 TP0048 TP0055 TP0054 prfA, - TP0051 oadB, - TP0057 oadA, - TP0056 hemK, - TP0052 hemK, - TP0052
* Calculated from Protein Sequence

Gene ID: TP0053

DNA Molecule Name:
1  

Genbank ID:
3322311

Gene Name:
nrdB  

Definition:
ribonucleoside-diphosphate reductase beta chain

Gene Start:
62793

Gene Stop:
61741

Gene Length:
1053

Molecular Weight*:
41186

pI*:
4.95

Net Charge*:
-10.72

EC:
1.17.4.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding
ribonucleotides, presursors that are necessary for DNA synthesis.

Rxn: 2'-DEOXYRIBONUCLEOSIDE DIPHOSPHATE + OXIDIZED THIOREDOXIN + H(2)O
= RIBONUCLEOSIDE DIPHOSPHATE + REDUCED THIOREDOXIN.

There are examples of 3D structures for the E. coli and mammalian
protein.

Blast Summary:  PSI-Blast Search
Significant hits to many ribonucleotide reductase proteins, including
proykaroytic, eukaryotic and viral genes. For example residues 1-349
are 20% similar to M2 ribonucleotide reductase of Mus musculus
(accession# X15666). Also residues 8-350 are 38% similar to
ribonucleoside diphosphate reductase beta subunit (nrdB) of Helicobacter
pylori (accession# AE000553).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0208
COG name: Ribonucleotide reductase beta subunit
Functional Class:  F
The phylogenetic pattern of COG0208 is ----YQ-cEBRhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Best match to blocks (BL00368), Ribonucleotide reductase of RIB2_HELPY.
Residues correspond to 40-94, 150-204, 73-127, 90-144, 112-141 197-236,
255-296 and 134-175 correspond to blocks.

ProDom Summary:  Protein Domain Search
Residues 180-350 are 41% similar and 56-138 are 51% similar to
RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN of RIR2_HELPY.
Residues 142-243 are 32% similar and 257-350 are 29% similar to
RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN of RIR2_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 33 to 321 (E-value = 6.4e-34) place TP0053 in the Ribonuc_red_sm family which is described as Ribonucleotide reductase, small chain (PF00268)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
180  
202

PDB Hit:
gi|1942079|pdb|1XIK|A Escherichia coli

Gene Protein Sequence:
MMESSTILQRRALFNEAGDIELHKRRMVGGNTTNLNDFNNMKYPWVSKWY
RQAMNNFWIPEEINMSSDVQDYRNLSAIEKTAYDKILSFLIFLDSIQTAN
LPNIGQYITANEINLCLTIQAFQEAVHSQSYSYMLDTICSPEERNDILYQ
WKDDEHLLARNKFIGNLYNEFQDDKSVLALLKVAIANYVLEGIYFYSGFM
FFYNLGRNNKMPGSVQEIRYINRDENTHLWLFRSIIQELQKEEPQVFTAR
NVRLFRDMIREGCEQEIKWGDYVIGDQIPGLNRHMVADYIRYLGNLRCEN
LGFEPLYEGHRVEPESMSWVSQYSNANLIKTDFFEAKSTAYAKSSAMVDD
L

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGGAAAGTTCAACGATACTGCAAAGACGCGCGCTGTTTAATGAGGC
AGGAGACATTGAACTTCATAAGCGACGCATGGTCGGGGGGAACACTACCA
ATCTCAACGACTTTAACAATATGAAGTATCCCTGGGTCAGCAAGTGGTAT
CGGCAGGCAATGAACAACTTCTGGATCCCCGAAGAAATCAACATGAGCAG
TGACGTGCAAGATTATCGTAATCTATCCGCTATCGAGAAAACCGCGTACG
ATAAAATCCTCTCCTTCCTTATTTTCCTAGATAGCATCCAGACTGCGAAT
CTGCCAAATATTGGTCAGTACATTACCGCAAATGAGATTAACCTGTGCCT
AACCATTCAGGCTTTCCAAGAGGCTGTGCATTCGCAGAGTTACAGTTACA
TGCTGGACACCATTTGCTCCCCCGAAGAACGCAATGACATTCTATACCAG
TGGAAGGACGACGAGCATCTGCTTGCGCGCAATAAATTCATTGGCAACTT
GTACAACGAGTTTCAAGATGACAAAAGCGTACTCGCACTGCTGAAGGTAG
CAATTGCGAATTATGTTTTGGAAGGAATTTATTTCTATTCGGGTTTTATG
TTCTTCTATAACTTGGGGCGTAATAACAAGATGCCCGGCTCGGTGCAGGA
AATTCGTTATATCAACCGCGATGAAAACACACACCTGTGGCTTTTTCGAT
CCATTATTCAAGAACTGCAAAAGGAAGAGCCACAGGTGTTCACTGCACGC
AATGTACGCTTATTTCGCGATATGATTCGCGAAGGATGCGAACAAGAAAT
TAAGTGGGGGGACTATGTCATTGGGGATCAGATCCCTGGACTAAATCGCC
ACATGGTGGCAGACTATATCCGGTATTTGGGTAATCTTCGTTGCGAAAAT
TTAGGCTTTGAGCCCTTGTACGAGGGGCACCGTGTAGAACCGGAATCGAT
GAGCTGGGTAAGTCAGTACAGCAACGCAAACTTGATTAAAACCGATTTTT
TTGAAGCAAAATCAACCGCGTACGCGAAGTCATCCGCAATGGTGGATGAT
CTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy