Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR37 IGR36 IGR38 IGR41 IGR40 IGR42 IGR43 IGR39 TP0048 TP0047 TP0050 TP0046 TP0049 nrdB, - TP0053 TP0055 TP0054 prfA, - TP0051 oadA, - TP0056 TP0048 TP0047 TP0050 TP0046 TP0049 nrdB, - TP0053 TP0055 TP0054 prfA, - TP0051 oadA, - TP0056 Type: tandem, Name:  - 226 Type: tandem, Name:  - 16 Type: tandem, Name:  - 17 Type: tandem, Name:  - 18 Type: tandem, Name:  - 282 TP0048 TP0050 TP0046 TP0049 nrdB, - TP0053 TP0047 TP0055 TP0054 prfA, - TP0051 oadA, - TP0056 hemK, - TP0052 hemK, - TP0052
* Calculated from Protein Sequence

Gene ID: TP0052

DNA Molecule Name:
1  

Genbank ID:
3322310

Gene Name:
hemK  

Definition:
protoporphyrinogen oxidase

Gene Start:
60603

Gene Stop:
61646

Gene Length:
1044

Molecular Weight*:
38000

pI*:
9.51

Net Charge*:
15.79

EC:
1.3.3.4  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme and porphyrin  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Porphyrin and chlorophyll metabolism

Comment:
Could be involved in the oxidation of protoporphyrinogen into
protoporphyrin IX.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to hemK proteins. For
example residues 56-338 are 26% similar to HEMK_HAEIN, protoporphyrinogen
oxidase (hemK) of Haemophilus influenzae,(U32830).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Significant but unlikely hit to Blocks (BL01261),Uncharacterized
protein family UPF0020 proteins. Residues 177-203 and 239-148
correspond to blocks.

ProDom Summary:  Protein Domain Search
Residues 87-122 are 55% similar to PROTOPORPHYRINOGEN OXIDASE of HEMK_HAEIN.


Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
151  
169
non-globular  
250  
317

PDB Hit:
none

Gene Protein Sequence:
MYCVSRECNLVQELCTIRQARMYARALFQDAPCLRGQNTPLLDADLILSK
LLAKPRAWILAHQQDEIASVAHEFKRLVHLRCRGRALAYLTREKEFFGLR
FRVTRATLIPKPDTELLVESVLAHVASQMMKPRSVSVHKDTSALPVLKIF
EACTGCGCIAIALMHMLRARGTPPLYVIASDICMRALAVARYNARRLLDV
SANSRVRFVHADVRAPIPFFSPSEGTDVVQERGVCVPYDVICANPPYVPS
AQARALLQDGRGEPLGALDGGADGLDLVRAFAHHSAAALKEGGCVFCEVG
SNHAQRAARIFQAAGFATVKISKDLSGKERLISGILRSQSRAVTAPSG

Gene Nucleotide Sequence:  Sequence Viewer
GTGTATTGCGTCTCGAGAGAGTGTAATCTAGTGCAAGAACTCTGTACGAT
TCGACAGGCGCGTATGTACGCGCGAGCGTTGTTTCAAGACGCCCCCTGTT
TGCGCGGACAGAACACACCGCTTTTAGATGCAGACCTTATTCTGTCGAAG
TTGCTTGCGAAGCCGCGTGCGTGGATTCTCGCCCACCAGCAGGATGAGAT
TGCCTCCGTTGCACACGAGTTTAAGCGTCTCGTGCATCTTCGTTGTAGGG
GACGTGCGTTGGCGTATCTGACTCGAGAAAAAGAGTTTTTTGGTCTGAGA
TTCCGTGTCACCCGTGCTACGCTTATCCCTAAACCGGATACCGAATTGCT
TGTAGAAAGTGTCCTGGCGCACGTTGCGTCCCAAATGATGAAGCCGCGTT
CAGTATCTGTGCATAAAGACACAAGTGCACTGCCTGTCTTGAAGATATTC
GAGGCGTGTACGGGATGCGGGTGTATTGCCATTGCACTTATGCATATGTT
GCGTGCGCGTGGCACGCCACCTCTCTATGTCATTGCATCCGACATTTGCA
TGCGGGCCCTTGCCGTAGCGCGGTATAACGCGCGCCGACTCTTGGATGTA
TCTGCAAATTCGCGCGTACGTTTCGTGCACGCAGATGTGCGTGCTCCTAT
TCCGTTCTTTTCTCCTTCTGAAGGCACGGACGTGGTACAGGAGCGCGGGG
TGTGCGTTCCGTATGATGTGATATGTGCAAATCCGCCTTACGTACCGAGT
GCGCAAGCGCGCGCGCTGTTGCAGGACGGGAGAGGGGAGCCTCTCGGTGC
CTTAGATGGGGGTGCAGATGGGCTAGACTTGGTTCGCGCATTCGCACACC
ACAGTGCCGCAGCGCTAAAGGAAGGCGGGTGCGTGTTTTGCGAGGTCGGC
TCAAACCACGCACAACGTGCAGCGCGCATCTTCCAGGCAGCAGGGTTTGC
CACGGTGAAAATTTCAAAAGATCTCTCCGGGAAAGAGCGCCTGATTAGCG
GGATACTGCGCTCGCAGTCTAGAGCTGTAACAGCGCCGAGTGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy