Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR37 IGR36 IGR38 IGR34 IGR41 IGR40 IGR42 IGR43 IGR39 IGR35 TP0048 TP0047 TP0050 TP0046 TP0045 TP0049 nrdB, - TP0053 TP0054 prfA, - TP0051 gidA, - TP0044 TP0048 TP0047 TP0050 TP0046 TP0045 TP0049 nrdB, - TP0053 TP0054 prfA, - TP0051 gidA, - TP0044 Type: tandem, Name:  - 18 Type: tandem, Name:  - 15 Type: tandem, Name:  - 282 Type: tandem, Name:  - 16 Type: tandem, Name:  - 17 Type: tandem, Name:  - 226 TP0047 TP0050 TP0046 TP0045 TP0049 nrdB, - TP0053 TP0048 TP0054 prfA, - TP0051 gidA, - TP0044 hemK, - TP0052 hemK, - TP0052
* Calculated from Protein Sequence

Gene ID: TP0050

DNA Molecule Name:
1  

Genbank ID:
3322308

Gene Name:


Definition:
phosphoribosyltransferase

Gene Start:
59427

Gene Stop:
58822

Gene Length:
606

Molecular Weight*:
23193

pI*:
8.13

Net Charge*:
2.11

EC:
2.4.2.-  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Lecoq K, Konrad M, Daignan-Fornier B.
Yeast GMP kinase mutants constitutively express AMP biosynthesis genes by phenocopying a hypoxanthine-guanine phosphoribosyltransferase defect.
Genetics. 2000 Nov;156(3):953-61.
PMID: 11063676

Comment:
This protein is likely a phosphoribosyltransferase.

There are several examples of 3D structures of phosphoribosyltransferases
in the database.

Blast Summary:  PSI-Blast Search
Significant hits to many phosphoribosyltransferases. For example residues
1-170 are 22% similar to HPRT_RAT. Additionally residues 3-184 are 41%
similar to B. burgdorferi predicted coding region BB0103 [Borrelia burgdorferi]
(accession# AE001123).

COGS Summary:  COGS Search
BeTs to 6 clades of COG2236
COG name: Predicted phosphoribosyltransferases
Functional Class:? R
The phylogenetic pattern of COG2236 is A--KY-------uj--ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Significant hit to blocks (BL00103), Purine/pyrimidine phosphoribosyl
transferases proteins of HPRT_ECOLI. Residues 94-109 match blocks.

ProDom Summary:  Protein Domain Search
Residues 91-137 are 36% similar to PHOSPHORIBOSYLTRANSFERASE of APT_ECOLI,
however the E value is quite weak.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MKKRFIPYNVIRDEGFGMARRIVADRFVPTVMYVPIRGGVYLGNVLNEYL
TIAYKAEPPILYAAVVAHSHCDLRKRRVISVDGWTYPPEYLRVGDKVLIV
DDIFDSGATINYIASLLMQKGLARGDIRVAVFNYKVFVGEKQPPVLPDYW
CIKHEVRSEADNEWFHYMSHELSGLTAAELEQYYYAQNPALRKTLADINN
QL

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAAAGCGATTTATTCCGTACAATGTGATCCGTGATGAGGGTTTCGG
TATGGCCCGGCGCATCGTGGCAGACAGGTTCGTGCCAACGGTTATGTACG
TCCCCATACGGGGTGGAGTATATCTGGGTAACGTGCTCAATGAGTATTTA
ACCATCGCGTACAAGGCAGAGCCTCCTATCCTGTACGCAGCGGTAGTTGC
TCACTCGCACTGTGATTTGCGTAAGCGGCGCGTCATCAGCGTAGATGGCT
GGACCTACCCTCCTGAGTACCTACGCGTCGGGGATAAGGTGCTCATCGTA
GATGATATCTTCGATTCAGGCGCAACCATCAACTACATCGCTTCCCTGCT
TATGCAAAAGGGCCTTGCGCGTGGCGACATCCGCGTGGCTGTCTTCAATT
ACAAAGTATTCGTGGGAGAAAAACAGCCCCCGGTGTTGCCGGACTACTGG
TGCATCAAGCACGAGGTACGTAGCGAGGCAGATAACGAGTGGTTCCATTA
CATGAGCCACGAGCTCTCTGGGCTTACTGCAGCGGAGCTCGAGCAGTACT
ACTACGCGCAGAACCCTGCCCTGCGCAAAACGTTGGCTGATATCAACAAT
CAGCTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy