Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR37 IGR36 IGR38 IGR33 IGR34 IGR40 IGR39 IGR35 TP0048 TP0047 TP0050 TP0046 TP0045 TP0049 prfA, - TP0051 gidA, - TP0044 slt, - TP0043 TP0048 TP0047 TP0050 TP0046 TP0045 TP0049 prfA, - TP0051 gidA, - TP0044 slt, - TP0043 Type: tandem, Name:  - 282 Type: tandem, Name:  - 15 Type: tandem, Name:  - 16 Type: tandem, Name:  - 17 TP0047 TP0050 TP0046 TP0045 TP0049 TP0048 prfA, - TP0051 gidA, - TP0044 slt, - TP0043 TP0042 TP0042
* Calculated from Protein Sequence

Gene ID: TP0045

DNA Molecule Name:
1  

Genbank ID:
3322300

Gene Name:


Definition:
adenosine aminohydrolase (deaminase)

Gene Start:
55437

Gene Stop:
54541

Gene Length:
897

Molecular Weight*:
34530

pI*:
5.92

Net Charge*:
-8.13

EC:
3.5.4.4  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism

Comment:
The ADD protein catalyzes the deamination of adenosine to
produce inosine. A 3D structure has been determined for the
mouse protein. Deficiency in humans results in severe
immunodeficiency disease. The E.coli enzyme is a metalloprotein.


Blast Summary:  PSI-Blast Search
Numerous hits to adenosine deaminase sequences, many of
which are eukaryotic. Residues 8-278 are 18% similar to
the E.coli ADA.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1816
COG name: Adenosine deaminase
Functional Class:  F
The phylogenetic pattern of COG1816 is ----y---e-r------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 3-34, 100-131, 164-216, 182-222, 193-224, and
239-291 all support a role of adenosine deaminase as seen
in blocks BL00485A,C,D.

ProDom Summary:  Protein Domain Search
Residues 84-277 are 39% similar to an adenosine aminohydrolase deaminase
domain observed in ADD_STRVG.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
Residues 9 to 297 (E-value = 3.8e-103) place TP0045 in the A_deaminase family which is described as Adenosine/AMP deaminase (PF00962)

PDB Hit:
gi|493801|pdb|1ADD| Adenosine Deaminase (E.C.3.5.4.4) Complexed With 1-Deaza-Adenosine (Daa)

Gene Protein Sequence:
MKSLEYYRSQPKADVHTHLNLSMKYERYKQWSGVVIPNFPRKMRGLDEMH
EIIGEYTRPQCKTAQDVLNLFTMSIEDAIADNVVVMETSVDIGFITHYEE
NLDHFLCDLSDLHRRYKRNVTLHFELGISKIRERSFVEQWAEPMMRSGIF
ENIDLYGPEISEGIEDFIYIFKLAEKYHLKKKAHVGEFSDAQSVRHFVEI
FNLDEVQHGIGAATDENVLRFLAERKVRCNVCPTSNVMLNAVECLEKHPI
KKMMDAGVRVGLGTDDLLFFGKTNSEQLFDMVSCGLITELHAEALLAVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAGTCTTGAATATTATCGATCACAGCCAAAAGCAGATGTGCACAC
GCATCTGAATTTGAGTATGAAATACGAACGATATAAGCAATGGTCAGGAG
TAGTCATTCCAAACTTTCCACGTAAAATGCGCGGGCTCGACGAAATGCAT
GAAATTATTGGTGAGTACACGCGTCCTCAGTGTAAAACTGCGCAAGACGT
GTTGAATTTGTTTACCATGTCCATAGAGGATGCCATTGCAGACAATGTCG
TCGTAATGGAGACATCAGTTGATATTGGCTTTATCACCCATTATGAAGAA
AATTTGGATCATTTCTTATGTGATTTAAGCGATCTGCATCGACGCTACAA
GCGCAATGTTACCCTTCACTTTGAGCTCGGTATCTCCAAAATACGAGAGC
GCAGCTTCGTAGAACAGTGGGCTGAGCCCATGATGCGAAGCGGTATCTTT
GAAAATATTGACCTCTACGGTCCAGAGATTTCCGAAGGAATCGAAGATTT
CATCTATATTTTTAAACTGGCCGAGAAGTATCACTTAAAAAAGAAAGCCC
ACGTAGGCGAGTTCTCTGATGCGCAATCGGTACGGCACTTTGTCGAAATA
TTTAACCTGGACGAAGTCCAACATGGCATCGGAGCCGCTACTGACGAGAA
CGTTTTGCGGTTTCTAGCTGAAAGAAAAGTTCGCTGTAACGTATGTCCAA
CCAGTAATGTCATGCTCAACGCGGTGGAATGCCTAGAAAAACATCCTATA
AAAAAAATGATGGATGCAGGGGTCCGTGTTGGGTTAGGAACTGACGATCT
TCTCTTTTTTGGAAAAACAAATAGCGAACAATTGTTTGATATGGTTTCCT
GTGGCCTTATCACCGAACTTCACGCCGAAGCGCTCCTTGCTGTGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy