Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR32 IGR33 IGR30 IGR34 IGR35 IGR31 TP0046 TP0045 TP0038 TP0041 TP0039 mcp-1, - TP0040 gidA, - TP0044 slt, - TP0043 TP0046 TP0045 TP0038 TP0041 TP0039 mcp-1, - TP0040 gidA, - TP0044 slt, - TP0043 Type: tandem, Name:  - 14 Type: tandem, Name:  - 15 TP0046 TP0045 TP0038 TP0039 mcp-1, - TP0040 gidA, - TP0044 slt, - TP0043 TP0042 TP0041 TP0042
* Calculated from Protein Sequence

Gene ID: TP0043

DNA Molecule Name:
1  

Genbank ID:
3322298

Gene Name:
slt  

Definition:
soluble lytic murein transglycosylase

Gene Start:
50418

Gene Stop:
52547

Gene Length:
2130

Molecular Weight*:
81742

pI*:
10.21

Net Charge*:
28.35

EC:
3.2.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Nucleotide metabolism; Aminosugars metabolism

Comment:
The SLT transglycosylase motif is clearly present in the
C-terminus of this sequence. The origin of the N-terminus is
mysterious. SL murein transglycosylases cleave beta-1,4-glycosidic
bonds and may thereby play a role in murein recycling.
A 3D structure is available for the E.coli SLT. Residues 69-174 are
26% similar to TP0815 and may suggest an origin for the
N-terminal amino acids.


TP0043 was assigned the EC 3.2.1.- in our original annotation. Comparison of our annotation with the annotation done by KEGGs leads us to re-examine our original annotation.

Looking at the results of Psi-BLAST (2 iterations), we observed that the C-terminal of TP0043 has several significant hits to the C-terminal of
SLT proteins entries in Swiss-Prot. These SLT proteins are assigned the EC number 3.2.1.-. No similarities found in N terminal residues of TP0043.
Blastx does not add any new information thus not supporting the possibility of a frameshift.

Is N-terminal conservation necessary through out evolution necessary for the conservation of function? Further studies will be necessary to answer this question.


Blast Summary:  PSI-Blast Search
Numerous hits over the C-terminus to SL transglycosylase
sequences, e.g., residues 487-706 are approximately 31%
identical to the Borrelia enzyme.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0741
COG name: Soluble lytic murein transglycosylase and related regulatory proteins
Functional Class:  M
The phylogenetic pattern of COG0741 is -----QVcEB-HUJ--oL--x
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 564-596 support a prokaryotic transglycosylase
function as observed in block BL00922 and in sequence SLT_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 546-659 are 28% similar to a P7 protein motif
found in bacteriophage (VPO7_BPPRD) but belonging to the
bacterial family of SLT proteins. Residues 571-630 more
weakly correspond to a transglycosylase domain of SLT_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
Residues 548 to 664 (E-value = 1.2e-40) place TP0043 in the SLT family which is described as Transglycosylase SLT domain (PF01464)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
40
non-globular  
384  
460

PDB Hit:
gi|1827737|pdb|1SLY| Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A Inhibitor-Enzyme Complex, Lysozyme, Peptidoglycan, Hydrolase, Glycosidase, Periplasmic, Glycosyltransferase Mol_id: 1; Molecule: 70-Kda Soluble Lytic Transglycos...

Gene Protein Sequence:
MKFRHGKHLVWGGGFFSLLREGRLCLRVWCVVCVLVSWEGTVCARGAREV
DIPQFLRDKNYTPFLKPTDEFLEQVAAREGASYFIGLHLKRAKFSEEAHE
YFVRGAAQAAPYRQLCAHEAHNTGSPLQRLAFIEKQLHVLNAGSDARTKT
QQQTLRLLRSRVLFELERYYSLRTVVESWYNDRALAPHTSAQFAALIAAL
PDLPRIFKEVHGARVDVFHRNYKRGWERVRLLLRSSAWHTRYATNSVLSD
FGKAALYGSENSVKAAQVFLDHLAHLSRSTLSNAELEARLRFYCYFYAAR
LYSRSASHKKQALPLFKKAEKVATRRQDADNALWYYLDVLRALDFDSFFK
VLVESAPRWRSDSWFSDLVDYAIVQLTTQQDWGRLATLQEVLTHRALPER
SARVTYVLARSGTLSEESARRAYRTIFETAHSSLYYRVLAACALGIPLEE
ALYKVRSKRTPHPFLTPDESRAILQGYVDYHLDDMFYQAMVQFYPDIPLH
LAEHFANAHIQRSRWSDAVRIQSYAIRSHGARYSVEHLKIAYPRPWLDVI
QGYAGKYHIEEYLLFALIRSESLFQPQVISRAGAVGLAQLMRPTASDIAR
KLNIDTYDLTDPDINVRFGSLFFSDLIRRFDGSVFCALFSYNAGPSRVRK
WKKQRGSLPDDLFLETLPLAEPREYGRKILSAAVMYGYLYYQKQASDVVC
ALLPEFCRAS

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAATTCCGTCACGGTAAGCATCTCGTGTGGGGAGGTGGCTTTTTCTC
TCTCTTACGGGAGGGCAGGTTGTGCCTGCGCGTGTGGTGCGTGGTGTGTG
TCCTTGTCTCGTGGGAGGGCACTGTGTGCGCGCGCGGCGCTAGGGAGGTT
GATATCCCTCAGTTTTTGAGAGACAAAAACTACACTCCGTTTCTAAAGCC
AACAGATGAGTTTCTCGAGCAGGTCGCCGCGCGGGAAGGTGCAAGTTACT
TCATTGGGTTACACCTCAAGCGGGCCAAGTTTTCCGAAGAAGCTCACGAG
TACTTCGTACGTGGCGCAGCGCAGGCCGCACCGTACCGCCAGTTATGTGC
GCATGAGGCACACAATACAGGGAGTCCACTACAGCGTCTCGCCTTTATTG
AAAAACAGCTGCATGTCCTTAATGCAGGCAGCGATGCGCGAACCAAAACG
CAGCAACAGACACTTCGCCTTTTGCGTTCAAGGGTGCTCTTTGAACTCGA
ACGCTACTACAGTCTGAGAACGGTTGTTGAGTCTTGGTACAACGATAGGG
CACTTGCGCCCCATACGAGTGCACAATTTGCTGCGCTTATTGCGGCACTG
CCGGATCTGCCGCGTATCTTTAAGGAAGTACATGGTGCTCGTGTGGACGT
CTTTCACAGGAATTACAAACGGGGGTGGGAGAGAGTGCGATTGTTGTTGC
GCTCTTCTGCGTGGCACACGCGGTACGCTACAAATTCGGTTCTCTCCGAT
TTTGGGAAAGCAGCGCTTTACGGTAGTGAAAACAGTGTTAAAGCCGCGCA
GGTTTTTCTTGACCATCTTGCACATCTATCGCGCTCAACGTTGTCCAATG
CGGAATTAGAGGCACGACTGCGTTTTTATTGCTATTTTTATGCGGCGCGT
CTTTACTCGCGGTCCGCTTCTCACAAGAAGCAAGCGCTTCCCCTTTTCAA
AAAGGCAGAGAAAGTGGCCACAAGGCGGCAAGATGCTGATAATGCCCTGT
GGTATTACTTGGACGTACTGCGTGCATTGGACTTTGATTCTTTCTTTAAG
GTGCTTGTTGAAAGTGCACCACGTTGGCGTTCGGATTCTTGGTTTTCTGA
CCTTGTCGATTATGCAATTGTCCAGCTGACTACGCAGCAAGATTGGGGGC
GTCTGGCTACACTGCAAGAGGTGCTGACGCATAGAGCATTACCCGAGCGC
TCCGCGCGCGTTACGTATGTCCTTGCGCGTTCAGGTACGCTTTCAGAAGA
GAGTGCGCGCCGCGCTTACCGTACCATCTTCGAAACTGCGCATTCTTCCC
TTTACTATCGTGTTCTTGCTGCATGTGCATTGGGCATTCCTCTGGAAGAG
GCTTTGTATAAGGTGCGGAGTAAGAGAACACCGCATCCTTTTCTTACCCC
CGATGAGTCGCGTGCTATTCTCCAAGGTTATGTAGACTATCACTTGGACG
ATATGTTCTACCAAGCTATGGTACAGTTCTATCCTGACATTCCTCTCCAC
CTTGCAGAGCATTTTGCGAACGCACACATACAAAGATCACGATGGTCCGA
TGCCGTGCGCATTCAGTCGTACGCAATACGCTCTCACGGTGCGCGCTATT
CTGTAGAACACTTGAAGATTGCGTACCCGCGTCCGTGGCTTGACGTCATA
CAAGGCTATGCAGGGAAGTATCATATTGAGGAGTATCTGCTGTTTGCGCT
CATCCGGAGTGAAAGTCTGTTTCAGCCGCAGGTTATCTCTCGGGCGGGCG
CTGTAGGTCTTGCTCAATTGATGAGGCCAACCGCTTCAGATATCGCTCGT
AAGCTCAATATCGACACCTATGACTTAACTGACCCGGATATCAATGTTAG
ATTCGGCAGTCTGTTCTTTTCCGATCTCATTCGTCGCTTTGATGGCTCCG
TGTTCTGTGCCCTGTTCTCCTACAATGCGGGACCGTCGCGCGTCCGCAAA
TGGAAAAAACAGAGGGGAAGTCTGCCCGATGATCTGTTCCTCGAAACCCT
GCCTCTTGCAGAACCTCGGGAGTACGGGAGGAAGATCCTATCCGCAGCGG
TGATGTACGGGTACCTTTATTATCAGAAACAGGCTTCAGATGTTGTGTGT
GCGTTGCTTCCTGAATTCTGTCGTGCTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy