Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR24 IGR20 IGR18 IGR23 IGR25 IGR21 IGR22 IGR19 TP0033 TP0032 TP0034 fliG, - TP0026 TP0025 TP0031 TP0027 murA, - TP0029 TP0028 groEL, - TP0030 TP0033 TP0032 TP0034 fliG, - TP0026 TP0025 TP0031 TP0027 murA, - TP0029 TP0028 groEL, - TP0030 Type: tandem, Name:  - 9 Type: tandem, Name:  - 10 Type: tandem, Name:  - 11 TP0033 TP0032 TP0034 fliG, - TP0026 TP0025 TP0031 TP0027 murA, - TP0029 TP0028 groEL, - TP0030
* Calculated from Protein Sequence

Gene ID: TP0029

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murA  

Definition:
enol-pyruvyltransferase

Gene Start:
36911

Gene Stop:
38185

Gene Length:
1275

Molecular Weight*:
45531

pI*:
6.50

Net Charge*:
-3.10

EC:
2.5.1.7  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Nucleotide metabolism; Aminosugars metabolism

Comment:
This gene has been previously described as a putative
enol-pyruvyltransferase of Treponema pallidum, (X54111).

MurA adds phosphoenolpyruvate to UDP-N-acetylglucosamine.

AroA adds phosphoenolpyruvate to 3-phosphoshikimate.

Blast Summary:  PSI-Blast Search
Significant hits to many 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
for example residues 1-418 are 16% similar to AROA_KLEPN, 3-phosphoshikimate
1-carboxyvinyltransferase.

Additionally significant hits to many UDP-N-ACETYLGLUCOSAMINE
1-CARBOXYVINYLTRANSFERASE: for example residues 1-424 are 32% similar
to and residues 57-357 are 13% similar to MURA_ECOLI, UDP-N-ACETYLGLUCOSAMINE
1-CARBOXYVINYLTRANSFERASE.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0766
COG name: UDP-N-acetylglucosamine enolpyruvyl transferase
Functional Class:  M
The phylogenetic pattern of COG0766 is -----qvceBrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 6- 186 are 41% similar and residues 306- 421 are 32% similar
to UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE domain of
MURA_ACICA. Residues 188- 270 are 39% similar to UDP-N-ACETYLGLUCOSAMINE
1-CARBOXYVINYLTRANSFERASE domain of MURA_HELPY.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 8 to 414 (E-value = 5.8e-57) place TP0029 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
92  
224

PDB Hit:
gi|2392464|pdb|1NAW|A Enterobacter cloacae

Gene Protein Sequence:
MSCYRVEGGFPVSGCIRVCGNKNAALPCIAAAVLTQEPVLLQNVPDIEDV
AVMLTIFRAFGGSVERRGNHEYMLHLPQLQTCEVPCEAAQKVRASILFAG
PLLARGRKAVLPPPGGDVIGRRRLDTHFLALAALGAQVRLDGVFTFSANK
LVGCDVFLDEASVTATENVLMASVLAEGVTVITNAASEPHVQDLCHLLNA
MGARVSGIGSNVLTIEGVSALHGTTYTLGADFMEVGSLIGLAVVTRGALT
ISDVNVRDLRPLGFAFKKLGVIWSEQEHAVSVSASQDLRVNYDFGGMIPK
IDDGPWPAFPPDLTSIMTVVATQVEGVILIHEKMFESRMFFVDKLITMGA
RIILCDPHRALVSGPSALHGSDLVSPDVRAGMAMVLAACCARGVSIIRNV
YQIERGYERLVERLQAIGVRIWKEG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTGCTATCGTGTTGAAGGTGGGTTTCCCGTTTCAGGTTGTATTCG
CGTGTGTGGAAATAAGAATGCAGCGCTTCCCTGTATTGCGGCGGCAGTTC
TCACACAAGAGCCAGTGTTACTGCAAAATGTGCCCGACATTGAGGATGTG
GCGGTGATGTTAACTATCTTTCGTGCGTTTGGTGGGAGTGTTGAAAGGCG
TGGTAATCATGAGTACATGTTACATCTTCCTCAGTTACAGACGTGCGAAG
TGCCGTGCGAGGCTGCGCAGAAAGTGCGTGCTTCCATTCTTTTTGCAGGG
CCACTTCTTGCGCGTGGTAGAAAAGCAGTGCTTCCACCACCTGGTGGTGA
TGTTATTGGGCGCAGGAGACTTGATACGCATTTTCTTGCGCTTGCCGCAC
TTGGCGCACAAGTTCGTTTAGATGGGGTGTTTACTTTCTCTGCAAATAAG
CTGGTGGGATGTGATGTCTTCTTAGACGAGGCATCTGTGACGGCGACAGA
GAATGTGCTTATGGCTTCAGTTCTTGCCGAGGGGGTTACGGTAATCACGA
ACGCGGCGAGCGAACCGCATGTGCAAGATCTATGCCATTTGTTGAATGCG
ATGGGTGCGCGCGTCTCTGGCATCGGATCGAATGTTTTAACAATTGAGGG
GGTGAGCGCGTTGCATGGTACCACATATACACTTGGGGCTGATTTCATGG
AAGTAGGTTCGCTTATTGGGCTTGCGGTAGTAACGCGTGGAGCATTGACG
ATTTCGGATGTGAACGTACGTGATCTACGTCCACTAGGTTTTGCGTTTAA
AAAACTTGGAGTAATTTGGAGCGAGCAAGAGCACGCGGTAAGCGTCTCTG
CGTCGCAGGATCTGCGGGTAAATTACGATTTTGGCGGTATGATTCCTAAA
ATAGATGATGGCCCGTGGCCTGCATTTCCGCCGGATCTGACTAGCATTAT
GACAGTGGTGGCGACTCAAGTCGAAGGGGTTATATTGATTCATGAGAAAA
TGTTTGAGTCGCGTATGTTTTTTGTGGACAAGTTAATTACCATGGGTGCG
CGTATCATCCTGTGTGACCCGCATCGGGCGCTTGTTTCAGGTCCGAGTGC
ATTGCATGGGAGTGACCTGGTATCTCCTGATGTGCGTGCGGGAATGGCGA
TGGTGCTTGCAGCGTGTTGTGCGCGCGGGGTAAGTATAATCCGTAACGTG
TATCAAATTGAGCGTGGATATGAACGTCTAGTGGAGCGTTTGCAGGCAAT
TGGTGTCCGTATTTGGAAAGAGGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy