Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR11 IGR10 IGR12 IGR9 greB,greA, - TP0019 TP0013 TP0017 TP0018 tprB, - TP0011 lon-1, - TP0016 greB,greA, - TP0019 TP0013 TP0017 TP0018 tprB, - TP0011 lon-1, - TP0016 Type: tandem, Name:  - 6 greB,greA, - TP0019 TP0013 TP0017 TP0018 lon-1, - TP0016 TP0012 TP0014 pheT, - TP0015 TP0014 pheT, - TP0015 tprB, - TP0011 TP0012
* Calculated from Protein Sequence

Gene ID: TP0016

DNA Molecule Name:
1  

Genbank ID:
3322266

Gene Name:
lon-1  

Definition:
ATP-dependent protease LA (lon)

Gene Start:
15743

Gene Stop:
18313

Gene Length:
2571

Molecular Weight*:
95797

pI*:
7.33

Net Charge*:
4.35

EC:
3.4.21.53  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Serrano M, Hövel S, Moran CP, Henriques AO, Völker U.
Forespore-specific transcription of the lonB gene during sporulation in Bacillus subtilis.
J Bacteriol. 2001 May;183(10):2995-3003.
PMID: 11325926

Liu J, Cosby WM, Zuber P.
Role of lon and ClpX in the post-translational regulation of a sigma subunit of RNA polymerase required for cellular differentiation in Bacillus subtilis.
Mol Microbiol. 1999 Jul;33(2):415-28.
PMID: 10411757

Comment:
The Lon protein participates in hydrolysis of large proteins such as
globin, casein, and denatured serum albumin, in presence of ATP.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed significant hits to many lon genes. For example
residues 354-838 are 23% similar and residues 68-130 were 30% similar
to ATP-dependent protease La (lon) of Archaeoglobus fulgidus,(AE001079).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1068
COG name: ATP-dependent unnamed protease
Functional Class:? O
The phylogenetic pattern of COG1068 is ------v-e--h-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Significant (99%+) hit to blocks (BL01046) ATP-dependent serine
proteases, lon family: Residues 576- 621 are 735- 778, 790- 830
are well matched.

Also significant but unlikely hit to blocks (PR00449) TRANSFORMING
PROTEIN P21 RAS SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 357- 674 are 22% similar, residues 768- 832 are 41% similar,
and residues 703- 715 are 69% similar to PROTEASE LA HOMOLOG domain of
LONH_HAEIN.


Paralogs:  Local Blast Search
This protein appears to be paralogously related to TP0524, also a
lon-related sequence: residues 719-826 are 29% similar to TP0524.
The same residues show weaker E-values but comparable similarity to
AE001162 and AE001135, lon-related sequences from Borrelia.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
172  
265
coil-coil  
413  
440

PDB Hit:
none

Gene Protein Sequence:
MLGNLMLGPYCRSSLWRELSWQEVTGIVAPDTIAYLKARAQDHPFLLAHE
RACAAIRLGMRMYGDGYNICVIGASGTGKRTTLQYLLKDFVPRPEQMWDI
AYAYNFVHPHEPQVLQFPAGEGMPFATALRRSVNAILNTAQDIVKSDAFL
RERRTLLADIETRECAELSRIEAELYTRGFRVRWHRKRGTYSFDLVPLLK
GKDSSFEALHDLASRAKLSRCVVHELHARYRLSCDEVSSLLHTLRTARRA
ARRRLAQYYRARLRLIILEQMACIKKRVACYAPVFSPPPVSCAAEQTERE
KTSSSRLIEVPHEFEEMRARIISYIERIQTDVQVRVQCLMSMRISALVKK
RFFDRYTLNFVCVHTEHAGYVFTEHQPNLANLCGSIESKGNEGDTLENGH
LRIRAGALHRAHAGVLIVQLEDLLAEEEAWTHLKRALRTKQVLLPAGSSQ
SQGMLRPEGVPLTCKLVLVGEPCSFERLSQEDSSFRELFKVCAEFDTSMP
NSDKNQVALIAYLDRVVARYGTFSLDSSAYARLLAYAEELAESHTRLSTS
FVQIADLVLESHAVAVDMHPDVSVITAHVVQEALNRRQYVCSRARERFQR
MIACGELLVEVQGYRIGRINALAIEEHCGHSFGIVISLTAQASAGKEGVM
NIEREAGLSGEIYDKAHLIITSLLREKCLSAFADAAFDPAVDDLGKGQDS
FPLCLSAALCFEQSYHGIDGDSASAAEFLVLLSAIGRFPLRQDRAITGSV
NQLGQVQAIGGVSEKISGFYDVCALNGLTGMQGVLIPKSSCAQLFLPERV
QDAVRAGTFHVWAVCTIDDALELMVPDDLKEQGSAQLYQCVRARLRDFYV
TVKGHCE

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTGGGGAACTTGATGTTGGGGCCCTATTGCCGTAGCTCGCTCTGGCG
AGAGCTTTCCTGGCAAGAAGTTACGGGTATCGTTGCTCCTGACACTATTG
CGTATCTGAAAGCCCGTGCGCAGGATCACCCCTTTTTGCTAGCGCATGAA
CGTGCCTGCGCTGCGATACGTCTTGGGATGAGAATGTACGGTGACGGCTA
CAATATCTGTGTGATTGGCGCGTCAGGCACCGGGAAGCGCACTACGCTCC
AATATCTATTAAAAGATTTTGTACCTCGTCCCGAGCAAATGTGGGATATA
GCGTATGCATACAATTTTGTGCATCCGCACGAACCGCAGGTGCTGCAGTT
TCCGGCGGGAGAAGGGATGCCTTTTGCTACGGCGTTGAGGAGATCGGTTA
ACGCTATTCTCAATACAGCACAGGATATTGTGAAAAGTGATGCCTTCTTA
CGTGAGCGGCGCACATTGCTGGCTGATATTGAAACACGTGAGTGTGCTGA
GCTTTCACGTATTGAAGCGGAGTTGTATACGCGTGGGTTTCGTGTGAGAT
GGCATAGGAAACGTGGTACGTACTCCTTTGATTTAGTTCCCCTATTAAAG
GGAAAAGACAGTAGCTTTGAAGCGCTGCACGATTTAGCTTCCCGCGCGAA
GCTTTCTAGATGTGTAGTACACGAACTCCATGCGCGATATCGTCTTTCCT
GTGATGAGGTTTCTTCGCTGCTCCATACGTTGCGCACTGCGCGGCGGGCC
GCGCGTAGGCGTCTTGCGCAGTACTACCGTGCGCGTTTGCGGTTAATTAT
CCTCGAGCAGATGGCCTGTATTAAAAAACGCGTGGCGTGTTATGCACCGG
TTTTTTCCCCTCCACCTGTTTCGTGTGCGGCGGAACAGACGGAAAGGGAG
AAGACTTCCTCTTCTCGCCTCATTGAGGTGCCGCATGAATTTGAAGAAAT
GCGTGCGCGCATCATATCGTACATAGAGCGGATACAAACCGATGTGCAGG
TGCGGGTACAGTGTTTAATGTCAATGCGTATTTCTGCACTAGTAAAAAAG
CGGTTTTTCGATCGCTATACCTTAAATTTCGTGTGTGTGCACACAGAACA
TGCGGGGTATGTGTTTACGGAGCATCAGCCGAATTTGGCGAATTTATGTG
GATCGATTGAAAGCAAGGGGAATGAAGGGGATACGCTGGAGAATGGGCAT
TTACGCATTCGTGCAGGTGCGCTGCATCGAGCGCATGCAGGTGTACTCAT
CGTGCAGCTCGAAGATCTACTGGCGGAGGAAGAAGCATGGACACATTTGA
AGCGTGCGCTGCGTACCAAGCAGGTGTTACTCCCAGCGGGTAGTTCCCAG
TCCCAAGGTATGTTGCGGCCTGAAGGAGTTCCGCTCACATGCAAGCTTGT
TTTGGTTGGCGAGCCATGCTCTTTCGAACGTCTATCTCAGGAAGATTCCT
CGTTCCGAGAACTATTTAAGGTGTGTGCAGAATTTGATACGAGCATGCCG
AATTCTGATAAGAATCAAGTTGCTTTGATAGCCTACCTTGATAGAGTTGT
GGCGCGTTATGGCACCTTCTCACTTGATTCCTCAGCGTACGCGCGATTGT
TAGCATATGCGGAAGAACTGGCAGAGAGTCATACACGGCTCAGTACTTCT
TTTGTACAAATTGCAGATTTAGTATTGGAGTCTCATGCAGTGGCCGTGGA
TATGCATCCAGATGTGTCGGTGATTACTGCGCATGTGGTGCAGGAAGCGC
TGAATCGCAGGCAGTACGTGTGTTCCCGCGCGCGGGAGCGTTTTCAGCGC
ATGATAGCCTGTGGAGAGTTATTGGTAGAGGTACAGGGATATCGAATAGG
GAGAATTAACGCGCTGGCAATCGAAGAACATTGCGGCCATAGCTTTGGCA
TAGTAATTTCGTTAACGGCACAGGCATCCGCGGGTAAGGAAGGAGTGATG
AATATTGAGCGGGAGGCAGGTCTTTCGGGGGAAATTTATGATAAGGCGCA
TTTAATCATCACTTCGCTATTGCGTGAGAAGTGCTTGTCTGCTTTTGCAG
ATGCTGCATTTGATCCAGCTGTGGATGACCTTGGAAAGGGGCAGGATAGT
TTTCCACTGTGTCTTTCTGCAGCGCTTTGTTTTGAACAGTCGTATCACGG
GATTGATGGGGATTCGGCGTCTGCTGCAGAATTTTTAGTATTGCTTTCTG
CGATTGGCCGGTTTCCTCTTCGGCAGGACCGCGCAATAACAGGAAGTGTG
AACCAGTTGGGACAAGTGCAAGCTATTGGAGGAGTGAGCGAGAAGATCAG
TGGCTTTTATGACGTCTGTGCTCTGAACGGACTGACGGGAATGCAGGGAG
TTTTGATCCCAAAGAGTAGTTGTGCACAATTGTTTTTGCCTGAACGTGTG
CAGGATGCGGTGCGTGCTGGTACGTTTCACGTGTGGGCGGTATGCACAAT
TGATGATGCGCTGGAATTGATGGTGCCGGACGATTTGAAAGAGCAGGGAA
GTGCTCAGCTCTACCAGTGTGTGCGTGCGCGTTTGCGGGATTTTTATGTC
ACAGTGAAAGGACACTGCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy