Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR8 IGR11 IGR7 IGR10 IGR9 tprA, - TP0009 TP0010 TP0013 TP0017 TP0018 tprB, - TP0011 lon-1, - TP0016 tprA, - TP0009 TP0010 TP0013 TP0017 TP0018 tprB, - TP0011 lon-1, - TP0016 Type: tandem, Name:  - 6 tprA, - TP0009 TP0010 TP0017 TP0018 tprB, - TP0011 lon-1, - TP0016 TP0012 TP0014 pheT, - TP0015 pheT, - TP0015 TP0013 TP0012 TP0014
* Calculated from Protein Sequence

Gene ID: TP0015

DNA Molecule Name:
1  

Genbank ID:
3322265

Gene Name:
pheT  

Definition:
phenylalanyl-tRNA synthetase beta subunit

Gene Start:
13966

Gene Stop:
15777

Gene Length:
1812

Molecular Weight*:
67181

pI*:
6.06

Net Charge*:
-8.62

EC:
6.1.1.20  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
PheT charges tRNA with L-phenylalanine.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phenylalanyl-tRNA
synthetase beta subunit proteins. For example residues 1-603 are 37%
similar to phenylalanyl-tRNA synthetase beta subunit of Borrelia
burgdorferi,(AE001153).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0072
COG name: Phenylalanyl-tRNA synthetase beta subunit
Functional Class:  J
The phylogenetic pattern of COG0072 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 8-45 are 35% similar, residues 81- 540 are 23% similar and
residues 547- 601 are 23% similar to PHENYLALANYL-TRNA SYNTHETASE
ALPHA CHAIN domain of SYFA_YEAST

Additionally residues 235- 265 are 50% similar to CHAIN BETA LIGASE
PHERS TRNA PHENYLALANINE-- SYNTHETASE PHENYLALANYL-TRNA domain of SYFB_ECOLI
and residues 337- 588 are 26% similar to CHAIN BETA LIGASE PHERS TRNA
PHENYLALANINE-- SYNTHETASE PHENYLALANYL-TRNA domain of SYFB_THETH

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 329 to 397 (E-value = 1.9e-19) place TP0015 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
165

PDB Hit:
gi|2781286|pdb|1PYS|B Chain B, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Phenylalanyl-Trna Synthetase, Class Ii Aminoacyl-Trna Synthetase, Thermus Thermophilus, Rbd Domain, Sh3 Domain, Helix-Turn-Helix Motif Mol_id: 1; Molecule: Phenylalan...

Gene Protein Sequence:
MPKISIHEALFFELLGERCDDDTLERRLRSAKAELECSSFSVREDKEGGS
LSPGGEVCDPVQRTRGQASCVREGAFDARLLKIELNDTNRPDLWSTAGLA
RLLRVHAGGASRAAQYRAFLSDRCTVRDSYGRCVVVDARLQTIRPFIAGF
VARGTGLSEVRLWDLIQTQERLASNFGRRRCTLSLGCYRAQDICWPLAYR
AVLLAEVSFTPLGMSMPLSGEQILTQHPKGREYGHLLKDYSFVPLLVDAR
GEVLSLIPITNSASLGAVVTGDTELFIECSGTDMCAVLVAVNSLACDLSD
MGMQIEPVQITYSFDTPWGRSVTTPFYFQEKREVAHEQIDRLLGMPLPVA
DITEAFARMDCAVQVKQGTYVVEPAAYRNDFLHAVDLIEEVMLGRTLDRF
SPQVPCSFTVGRLSDLTLLTRKIKHLLVGFGYQEMIFHYLGSAREFCTRM
RCTADDLIEIENPLTESYRFVRRSIIPCLLSAELKSAHALYPHRIFEIGK
VAFCSPHGEHGTCTQQSLGFLNASQEASYNEVASLVSGLLYCLKLPYQVE
EAQDPRFVLGRQASICVHGSRVGIFGEIHPQVLSNWDIRMPCFAGELDVG
ALLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGAAAATTAGCATTCATGAGGCGTTGTTTTTTGAGCTGCTCGGTGA
ACGGTGCGACGATGATACGTTGGAGCGACGTTTGCGAAGTGCTAAGGCTG
AATTGGAGTGCAGCTCTTTTTCCGTGAGGGAAGATAAAGAGGGAGGGAGC
CTTTCGCCAGGAGGGGAGGTGTGCGATCCTGTGCAGAGGACGAGGGGTCA
GGCCAGCTGTGTACGTGAGGGTGCGTTTGATGCGCGTCTTTTAAAAATCG
AACTTAACGACACAAATCGTCCGGATTTGTGGTCTACAGCAGGGCTTGCG
CGCCTCTTGCGTGTTCACGCAGGGGGGGCTTCGCGCGCAGCGCAGTATCG
TGCATTTCTTTCAGATCGCTGTACGGTGCGCGACTCGTATGGGCGATGCG
TAGTAGTGGATGCGCGTTTGCAAACTATACGCCCTTTTATTGCTGGCTTT
GTGGCTCGGGGTACTGGACTGAGCGAAGTAAGACTGTGGGATCTAATACA
AACACAGGAAAGACTCGCCAGTAATTTTGGACGTAGGAGGTGTACCCTTT
CGCTGGGGTGTTACCGTGCACAGGATATATGTTGGCCACTCGCATACCGC
GCTGTCCTACTCGCAGAGGTAAGTTTCACGCCTCTCGGTATGTCCATGCC
GCTGTCTGGTGAGCAGATTCTGACGCAACATCCGAAAGGGCGTGAATATG
GTCATCTCCTCAAGGATTATTCTTTCGTTCCCTTATTAGTCGATGCTCGT
GGTGAGGTGCTTTCGCTTATTCCGATCACTAATAGCGCGTCGCTGGGTGC
AGTAGTGACCGGGGATACAGAACTATTTATCGAGTGTAGTGGTACGGATA
TGTGCGCAGTGCTAGTAGCGGTGAATAGCCTTGCGTGTGATCTTTCTGAT
ATGGGTATGCAGATTGAACCTGTGCAAATTACCTATAGTTTTGACACCCC
ATGGGGGAGGTCTGTTACTACCCCCTTTTATTTTCAAGAAAAAAGGGAGG
TTGCGCACGAGCAGATAGATCGTCTTTTGGGGATGCCCTTGCCTGTTGCA
GATATAACCGAAGCCTTTGCAAGGATGGACTGTGCCGTGCAAGTTAAGCA
GGGAACCTATGTCGTCGAGCCTGCAGCGTACCGTAATGATTTTCTCCATG
CGGTAGATCTGATTGAAGAAGTGATGCTGGGTAGAACGCTTGACCGTTTT
TCTCCGCAGGTTCCATGTTCTTTTACAGTGGGCAGACTGAGTGATCTGAC
CCTTTTGACGCGCAAAATTAAGCACCTTCTAGTTGGATTTGGTTATCAGG
AGATGATTTTTCATTATCTTGGCTCTGCCAGGGAGTTTTGCACGCGTATG
CGATGCACGGCAGATGATTTAATCGAGATAGAAAATCCTCTTACTGAAAG
CTACCGATTCGTGCGCAGGTCTATCATTCCGTGTCTTCTGTCAGCTGAGC
TAAAGTCAGCACATGCGTTGTATCCACATCGTATTTTCGAAATTGGAAAG
GTTGCCTTTTGCTCCCCTCATGGTGAACACGGTACATGCACGCAACAATC
ACTTGGATTCCTCAATGCCTCGCAGGAGGCAAGTTACAATGAGGTGGCGA
GCCTAGTTTCAGGACTTTTGTATTGTTTGAAACTTCCGTATCAGGTAGAG
GAAGCGCAGGATCCGCGGTTTGTCTTAGGCAGACAAGCGAGTATCTGCGT
GCATGGTTCTCGTGTGGGTATATTTGGGGAGATACATCCGCAGGTGCTGA
GTAATTGGGATATCCGCATGCCGTGCTTTGCTGGGGAACTTGATGTTGGG
GCCCTATTGCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy