Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR5 IGR8 IGR7 IGR6 IGR2 IGR4 IGR3 IGR1.1 tprA, - TP0009 TP0010 Tp75, - TP0006 TP0008 TP0007 recF, - TP0003 dnaA, - TP0001 tprB, - TP0011 gyrA, - TP0005 tprA, - TP0009 TP0010 Tp75, - TP0006 TP0008 TP0007 recF, - TP0003 dnaA, - TP0001 tprB, - TP0011 gyrA, - TP0005 Type: tandem, Name:  - 4 Type: tandem, Name:  - 1 Type: tandem, Name:  - 2 Type: tandem, Name:  - 3 Type: tandem, Name:  - 5 tprA, - TP0009 Tp75, - TP0006 TP0007 recF, - TP0003 dnaA, - TP0001 tprB, - TP0011 gyrA, - TP0005 TP0004 dnaN, - TP0002 TP0004 dnaN, - TP0002 TP0010 TP0008
* Calculated from Protein Sequence

Gene ID: TP0005

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrA  

Definition:
DNA gyrase subunit A (topoisomerase II)

Gene Start:
4391

Gene Stop:
6829

Gene Length:
2439

Molecular Weight*:
89922

pI*:
8.16

Net Charge*:
6.37

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
DNA gyrase negatively supercoils closed circular double-stranded DNA
in an ATP-dependent manner and also catalyzes the interconversion of
other topological isomers of double-stranded DNA rings, including
catenanes and knotted rings.

There is a 3D structure of the yeast protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits DNA gyrases
(Topoisomerase II). For example residues 1-810 are 44% similar to
GYRA_BACSU,(P05653).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class:? L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 511- 522 and 615- 659 represent a significant (98%) but
unlikely hit to block (BL00111); Phosphoglycerate kinase:
similar to PGKH_WHEAT.

ProDom Summary:  Protein Domain Search
Residues 35-212 are 61% similar to a DNA SUBUNIT A GYRASE
TOPOISOMERASE II IV ISOZYME BETA domain in GYRA_RICPR and residues
216-402 are 50% similar to A SUBUNIT DNA GYRASE TOPOISOMERASE IV
domain in GYRA_MYCSM. Residues 432-494 also correspond to a domain related
to DNA gyrase.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 36 to 484 (E-value = 6.2e-289) place TP0005 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)
Residues 508 to 557 (E-value = 9.6e-13) place TP0005 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 558 to 610 (E-value = 7.8e-11) place TP0005 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 614 to 661 (E-value = 7.7e-09) place TP0005 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 662 to 711 (E-value = 1.1e-16) place TP0005 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 712 to 762 (E-value = 6.7e-11) place TP0005 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 763 to 812 (E-value = 3.5e-08) place TP0005 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
335  
428
coil-coil  
429  
468

PDB Hit:
gi|1633273|pdb|1BGW| Topoisomerase Residues 410 - 1202, Isomerase, Topoisomerase, Dna-Binding, Phosphorylated Nuclear Protein Mol_id: 1; Molecule: Topoisomerase; Chain: Null; Fragment: Residues 410 - 1202; Engineered: Yes

Gene Protein Sequence:
MEEISTPEGGVLVPISIETEVKRAYIDYSMSVIVSRALPDVRDGLKPVHR
RILYAMEEKGLRFSGPTRKCAKIVGDVLGSFHPHGDASVYDALVRLGQDF
SLRYPVIHPQGNFGTIGGDPPAAYRYTEAKMARIAESMVEDIKKETVSFV
PNFDDSDVEPTVLPGRFPFLLANGSSGIAVGMTTNMPPHNLREIAAAISA
YIENPNLSIQELCDCINGPDFPTGGIIFGKNGIRQSYETGRGKIVVRARF
TIETDSKGRDTIIFTEVPYQVNTTMLVMRIGELARAKVIEGIANVNDETS
DRTGLRIVVELKKGTPAQVVLNHLFAKTPLQSSFNVINLALVEGRPRMLT
LKDLVRYFVEHRVDVVTRRAHFELRKAQERIHLVRALIRALDAIDKIITL
IRHSQNTELAKQRLREQFDFDNVQAQAIVDMQMKRLTGLEVESLRTELKD
LTELISSLEELLTSPQKVLGVVKKETRDIADMFGDDRRTDIVSNEIEYLD
VEDFIQKEEMVILISHLGYIKRVPVSAYRNQNRGGKGSSSANLAAHDFIS
QIFTASTHDYVMFVTSRGRAYWLKVYGIPESGRANRGSHIKSLLMVATDE
EITAIVSLREFSNKSYVFMATARGVVKKVTTDNFVNAKTRGIIALKLSGG
DTLVSAVLVQDEDEVMLITRQGKALRMSGREVREMGRNSSGVIGIKLTSE
DLVAGVLRVSEQRKVLIMTENGYGKRVSFSEFSVHGRGTAGQKIYTQTDR
KGAIIGALAVLDTDECMCITGQGKTIRVDVCAISVLGRGAQGVRVLDIEP
SDLVVGLSCVMQG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGAAATTAGCACCCCAGAGGGTGGCGTTCTTGTGCCCATTTCTAT
AGAGACAGAAGTCAAGCGTGCTTACATAGACTATTCTATGTCCGTCATAG
TTTCTCGTGCGCTTCCGGATGTCCGCGACGGTTTAAAGCCTGTTCACAGA
CGTATTCTCTACGCGATGGAGGAAAAAGGGCTACGCTTTTCAGGACCTAC
ACGGAAGTGTGCCAAGATAGTGGGGGACGTTTTGGGAAGCTTTCATCCTC
ATGGGGATGCGTCCGTCTATGACGCGCTAGTGCGTCTTGGGCAAGATTTT
TCCCTTCGTTATCCAGTCATTCATCCTCAAGGAAATTTCGGGACTATCGG
GGGCGACCCTCCGGCAGCGTATCGGTACACCGAAGCGAAGATGGCGCGTA
TTGCAGAATCTATGGTAGAGGACATAAAAAAGGAAACGGTTTCCTTTGTT
CCCAATTTTGACGATTCTGACGTAGAGCCCACGGTTCTTCCTGGAAGGTT
TCCTTTTCTTCTTGCGAATGGGTCCAGTGGTATTGCAGTTGGTATGACTA
CAAACATGCCACCGCATAATTTGCGTGAGATAGCCGCAGCTATCTCTGCG
TACATCGAGAACCCAAATCTTTCGATTCAGGAGTTATGCGATTGTATCAA
TGGTCCTGACTTTCCCACGGGAGGCATTATCTTTGGAAAGAACGGGATTA
GGCAGTCTTACGAAACAGGTCGAGGGAAAATTGTTGTCCGTGCTCGCTTT
ACCATCGAGACGGATTCAAAGGGTAGGGATACCATTATTTTTACAGAAGT
TCCGTATCAAGTTAATACTACCATGCTTGTTATGCGTATTGGGGAACTTG
CACGTGCGAAAGTGATCGAAGGTATTGCGAATGTAAACGACGAGACTTCC
GATCGTACAGGGCTACGCATAGTGGTAGAGCTCAAAAAGGGTACCCCCGC
ACAGGTAGTACTCAATCACCTGTTTGCAAAGACTCCCCTGCAGTCCTCTT
TTAATGTGATTAATCTTGCTTTGGTAGAGGGAAGACCTCGAATGCTCACG
CTCAAGGACCTAGTGCGCTACTTTGTAGAACACCGGGTCGATGTAGTGAC
TCGGCGTGCGCATTTTGAATTACGTAAGGCTCAGGAGCGCATACACTTGG
TGCGTGCGCTGATACGTGCCTTGGATGCCATTGATAAAATCATCACGCTT
ATCCGTCATTCGCAGAACACAGAGCTTGCAAAACAGCGTTTGCGTGAACA
ATTTGACTTTGACAACGTGCAGGCGCAGGCGATCGTAGATATGCAGATGA
AGCGCTTGACAGGTTTGGAAGTCGAGAGTTTGCGTACGGAATTGAAAGAT
TTGACGGAGCTGATTTCTTCTCTGGAGGAGTTACTTACTTCTCCCCAAAA
GGTCTTGGGAGTTGTTAAGAAAGAGACGCGTGATATCGCAGATATGTTTG
GGGATGATCGGCGTACAGATATTGTGAGCAATGAAATAGAATATCTGGAT
GTAGAAGATTTTATCCAGAAAGAGGAAATGGTTATTCTTATTTCCCATCT
TGGTTACATTAAGCGCGTTCCAGTGTCTGCGTATAGAAATCAGAATCGGG
GAGGAAAGGGCTCAAGTTCAGCGAATCTGGCGGCTCACGATTTTATTAGC
CAGATATTTACTGCATCAACACATGACTACGTGATGTTTGTCACGAGCCG
TGGGCGGGCCTATTGGCTAAAAGTATACGGGATTCCTGAATCTGGTCGGG
CGAATCGTGGTTCGCATATTAAGTCGCTTCTCATGGTAGCGACGGACGAG
GAGATCACGGCCATCGTATCTTTGAGAGAGTTTAGTAATAAAAGTTATGT
TTTTATGGCTACTGCGCGAGGTGTAGTTAAAAAGGTAACTACTGATAATT
TTGTGAATGCGAAGACGCGCGGTATTATAGCGCTTAAGCTGAGCGGAGGT
GACACGCTGGTGAGCGCAGTGTTGGTGCAGGACGAAGATGAAGTAATGCT
TATTACGCGTCAGGGAAAAGCATTGCGCATGTCGGGGAGGGAGGTGCGCG
AGATGGGTCGCAATTCCAGTGGGGTGATTGGGATAAAATTGACGTCCGAG
GACCTAGTGGCGGGGGTTTTGCGAGTAAGCGAACAACGGAAAGTACTGAT
AATGACGGAGAATGGATATGGTAAGCGGGTCAGTTTTTCAGAATTTTCTG
TACATGGGCGAGGGACTGCAGGACAGAAGATTTACACACAAACGGATAGA
AAAGGTGCTATAATAGGTGCTCTTGCTGTTCTCGATACAGATGAGTGTAT
GTGTATTACTGGTCAGGGAAAAACGATTCGCGTGGACGTGTGTGCAATCA
GCGTGCTGGGGCGTGGTGCGCAGGGCGTGCGTGTGTTGGATATCGAGCCA
TCGGATTTAGTAGTAGGACTTAGTTGTGTAATGCAGGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy