Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1692.1 IGR1689 IGR1690 IGR1687 IGR1688 IGR1691 IGR1692 IGR1686 gna33, - NG2048 glmS, - NG2045 metS,metG, - NG2044 NG2046 NG2043 NG2049 NG2047 NG2050 pilS, - NG2042 gna33, - NG2048 glmS, - NG2045 metS,metG, - NG2044 NG2046 NG2043 NG2049 NG2047 NG2050 pilS, - NG2042 gna33, - NG2048 glmS, - NG2045 metS,metG, - NG2044 NG2043 NG2047 NG2050 pilS, - NG2042 NG2046 NG2049
* Calculated from Protein Sequence

Gene ID: NG2045

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glmS  

Definition:
glucosamine--fructose-6-phosphate aminotransferase (GlmS)

Gene Start:
2021459

Gene Stop:
2019624

Gene Length:
1836

Molecular Weight*:
66479

pI*:
6.60

Net Charge*:
-5.59

EC:
2.6.1.16  

Functional Class:
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Aminosugars metabolism
Glutamate metabolism

Secondary Evidence:
Teplyakov,A., Obmolova,G., Badet-Denisot,M.A., Badet,B. and
Polikarpov,I.
Involvement of the C terminus in intramolecular nitrogen channeling in glucosamine 6-phosphate synthase: evidence from a 1.6 A crystal structure of the isomerase domain
Structure 6 (8), 1047-1055 (1998)
Medline: 98416699

Isupov,M.N., Obmolova,G., Butterworth,S., Badet-Denisot,M.A.,
Badet,B., Polikarpov,I., Littlechild,J.A. and Teplyakov,A.
Substrate binding is required for assembly of the active
conformation of the catalytic site in Ntn amidotransferases:
evidence from the 1.8 A crystal structure of the glutaminase domain of glucosamine 6-phosphate synthase
Structure 4 (7), 801-810 (1996)
Medline: 96434326

Dutka-Malen,S., Mazodier,P. and Badet,B.
Molecular cloning and overexpression of the glucosamine synthetase
gene from Escherichia coli
Biochimie 70 (2), 287-290 (1988)
Medline: 88281539

Walker,J.E., Gay,N.J., Saraste,M. and Eberle,A.N.
DNA sequence around the Escherichia coli unc operon. Completion of
the sequence of a 17 kilobase segment containing asnA, oriC, unc,
glmS and phoS
Biochem. J. 224 (3), 799-815 (1984)
Medline: 85121806

Gay,N.J., Tybulewicz,V.L. and Walker,J.E.
Insertion of transposon Tn7 into the Escherichia coli glmS
transcriptional terminator.
Biochem. J. 234(1): 111-117, 1986.
Medline: 86215091.



Comment:
For other 'glm' genes see NG2053 (glmU).

Oklahoma ID: NGO.2045c

For other aminotransferases, see NG0082 (avtA), NG0308 (bioA), NG0460, NG0646 (argD), NG1047 (aat), NG1241 (hisC), NG1283 (serC), NG1329 (tyrB), NG1452 (aspC).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to glutamine--fructose-6-phosphate transaminases. Residues 1-612 are 75% similar to the L-glutamine:D-fructose-6-phosphate aminotransferase in Moraxella catarrhalis (9965189).

Residues 1-612 are virtually identical to NMB0031 n N.meningitidis (11259082).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0449
COG name: Glucosamine-fructose-6-phosphate aminotransferase, contains aminotransferase and phosphosugar isomerase domains
Functional Class:  M
The phylogenetic pattern of COG0449 is -MtkYqvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000583 (Glutamine amidotransferase class-II) with a combined E-value of 1.9e-31.
    IPB000583A    25-35
    IPB000583B    70-79
    IPB000583C    99-127
    IPB000583D    596-611
***** IPB001347 (SIS domain) with a combined E-value of 1.2e-15.
    IPB001347A    71-79
    IPB001347B    344-369


ProDom Summary:  Protein Domain Search
Residues 2-176 are 51% similar to a (AMIDOTRANSFERASE GLUTAMINE ASPARAGINE SYNTHETASE) protein domain (PD000635) which is seen in GLMS_THIFE.

Residues 441-521 are 86% similar to a (AMINOTRANSFERASE GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE) protein domain (PD002268) which is seen in GLMS_THIFE.

Residues 341-399 are 66% similar to a (PROTEIN AMINOTRANSFERASE) protein domain (PD000868) which is seen in GLMS_THIFE.

Residues 523-612 are 76% similar to a (AMINOTRANSFERASE AMIDOTRANSFERASE) protein domain (PD002422) which is seen in GLMS_THIFE.

Residues 180-336 are 48% similar to a (AMINOTRANSFERASE AMIDOTRANSFERASE) protein domain (PD002531) which is seen in GLMS_THIFE.



Paralogs:  Local Blast Search


NG2045 is paralogously related to NG0263 (amidophosphoribosyltransferase (glutamine phosphoribosylpyrophosphate amidotransferase)) (4e-13).


Pfam Summary:  Pfam Search
Residues 2 to 135 (E-value = 2.6e-50) place NG2045 in the GATase_2 family which is described as Glutamine amidotransferases class-II (PF00310)
Residues 289 to 424 (E-value = 2.4e-30) place NG2045 in the SIS family which is described as SIS domain (PF01380)
Residues 462 to 598 (E-value = 2.5e-35) place NG2045 in the SIS family which is described as SIS domain (PF01380)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
382  
448
transmembrane  
413  
429

PDB Hit:
pdb|1JXA|1JXA-A GLUCOSAMINE 6-PHOSPHATE SYNTHASE WITH GLUCOSE 593.0 0e+00
pdb|1MOQ|1MOQ ISOMERASE DOMAIN OF GLUCOSAMINE 6-PHOSPHATE 389.0 0e+00
pdb|1GDO|1GDO-A GLUTAMINASE DOMAIN OF GLUCOSAMINE 6-PHOSPHATE 210.0 8e-55
pdb|1J5X|1J5X-A CRYS

Gene Protein Sequence:
MCGIVGAIRAHHNVVDFLTDGLKRLEYRGYDSSGIAVYSDGKIKRVRRVG
RVQLMEDAAREKGISGGIGIGHTRWATHGGVTEPNAHPHISGGMIAVVHN
GIIENFESERKRLEGLGYRFESQTDTEVIAHSINHEYAQNGGRLFEAVQE
AVKRFHGAYAIAVIAQDKPDELVVARMGCPLLVALGDDETFIASDVSAVI
AFTRRVAYLEDGDIALLASDGIKRLTDKNGLPAERKVKVSELSPASLEPG
PHSHFMQKEIHEQPRAIADTAEVFLDGGFIPENFGKNAKSVFESIRSVKI
LACGTSYYAALTAKYWLESIAKIPADVEIASEYRYRSVIADPDQLVITIS
QSGETLDTMEALKYAKSLGHRHSLSVCNVMESALPRESSLVLYTRAGAEI
GVASTKAFTTQLVVLFGLAVTLAKVRGVVSGEDEARYTEELRQLPGSVQH
ALNLEPQIAAWAQQFAKKTSALFLGRGIHYPIALEGALKLKEITYIHAEA
YPAGELKHGPLALVDENMPVVVIAPNDSLLDKVKANMQEVGARGGELFVF
ADLDSNFNATEGVHVIRAPRHVGELSPVVHTVPVQLLAYHTALARGTDVD
KPRNLAKSVTVE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGCGGTATCGTCGGCGCCATCCGCGCCCATCACAACGTCGTCGATTT
TCTGACCGACGGCCTCAAACGCCTCGAATACCGGGGTTATGACTCATCAG
GCATTGCTGTGTATTCAGACGGCAAAATCAAACGCGTGCGCCGCGTCGGA
CGCGTGCAGCTTATGGAGGACGCGGCACGCGAAAAAGGCATCAGCGGCGG
CATCGGCATCGGGCATACGCGCTGGGCGACACACGGCGGCGTTACCGAGC
CGAACGCCCACCCGCACATCAGCGGCGGTATGATTGCCGTCGTCCACAAC
GGCATCATCGAAAACTTTGAAAGCGAACGCAAACGCTTGGAAGGTTTGGG
ATACCGGTTTGAATCGCAAACGGATACCGAAGTCATCGCACACAGCATCA
ACCACGAATACGCGCAAAACGGCGGCAGGCTGTTTGAAGCCGTGCAGGAA
GCGGTCAAACGTTTCCACGGCGCATACGCCATCGCGGTTATTGCCCAAGA
CAAGCCTGATGAATTAGTTGTGGCGCGTATGGGCTGCCCGCTTTTGGTCG
CTTTGGGCGACGATGAAACCTTTATCGCTTCGGACGTATCCGCCGTCATC
GCCTTTACGCGCCGCGTGGCGTACCTCGAAGACGGCGACATCGCGCTGCT
GGCTTCAGACGGCATCAAACGGCTGACCGATAAAAACGGCCTGCCTGCCG
AACGCAAAGTCAAGGTATCCGAACTCTCGCCCGCCTCTTTGGAACCGGGT
CCGCACAGCCACTTTATGCAAAAAGAAATCCACGAGCAGCCGCGCGCGAT
TGCGGACACGGCGGAAGTTTTCCTCGACGGCGGATTCATCCCCGAAAACT
TCGGCAAAAATGCCAAAAGCGTGTTTGAAAGCATCCGCAGCGTCAAAATC
CTTGCCTGCGGCACGTCCTATTACGCCGCGCTGACCGCCAAATATTGGTT
GGAATCCATCGCCAAAATCCCGGCCGACGTCGAAATCGCAAGCGAATACC
GGTACCGCAGCGTGATTGCCGACCCCGACCAACTGGTCATTACCATTTCC
CAATCCGGCGAAACGCTGGACACGATGGAGGCTTTGAAATACGCCAAATC
TTTGGGACACCGCCACAGCCTCTCCGTCTGCAACGTGATGGAATCCGCCC
TGCCGCGCGAAAGCAGCCTTGTGCTTTATACCCGTGCCGGTGCGGAAATC
GGCGTCGCCTCGACTAAAGCATTTACCACGCAACTGGTCGTGCTGTTCGG
TTTGGCGGTAACGCTGGCGAAAGTGCGCGGCGTGGTATCCGGCGAAGATG
AAGCACGTTACACCGAAGAACTCCGCCAGCTTCCCGGCAGCGTGCAGCAC
GCTTTGAACCTCGAACCGCAAATTGCCGCTTGGGCGCAACAGTTTGCCAA
GAAAACCAGCGCGCTGTTTTTGGGGCGCGGCATCCATTACCCGATTGCCC
TTGAAGGTGCGTTGAAGCTAAAGGAAATCACCTACATCCACGCCGAAGCC
TATCCTGCCGGCGAACTGAAACACGGGCCGCTTGCCTTGGTGGACGAAAA
CATGCCCGTCGTCGTCATCGCGCCCAACGACAGCCTGTTGGACAAAGTCA
AAGCCAATATGCAGGAAGTCGGCGCGCGCGGCGGCGAACTTTTCGTCTTT
GCCGACCTCGACAGCAATTTTAATGCCACCGAAGGCGTACACGTTATCCG
CGCACCTCGCCACGTCGGCGAACTGTCCCCCGTCGTGCATACCGTCCCCG
TGCAGCTCCTCGCCTACCACACCGCCCTCGCGCGCGGCACGGATGTGGAC
AAGCCGCGCAACCTGGCGAAATCCGTAACCGTCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy